X-ray structure of the adduct between human serum transferrin with Fe3+ bound at the C-lobe and diruthenium tetraacetate chloride. Determined by X-ray diffraction at 2.26 Å resolution. Released 11 Mar 2026.
Explore 28MR in 3D Show helices and sheets RCSB PDB PDBe
28MR contains 37 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| α-helix | 13-26 | 14 | |
| β-strand | 36-41 | 6 | 1 |
| α-helix | 45-53 | 9 | |
| β-strand | 59 | 1 | 1 |
| β-strand | 60-62 | 3 | 2 |
| α-helix | 64-71 | 8 | |
| β-strand | 77-84 | 8 | 2 |
| β-strand | 85 | 1 | 3 |
| β-strand | 92 | 1 | 3 |
| β-strand | 94-102 | 9 | 4 |
| α-helix | 109-111 | 3 | |
| β-strand | 116-119 | 4 | 4 |
| α-helix | 125-129 | 5 | |
| α-helix | 130-135 | 6 | |
| α-helix | 136-138 | 3 | |
| α-helix | 140 | 1 | |
| α-helix | 142 | 1 | |
| α-helix | 146-151 | 6 | |
| β-strand | 156-158 | 3 | 4 |
| α-helix | 168-170 | 3 | |
| α-helix | 187-196 | 10 | |
| β-strand | 202-206 | 5 | 4 |
| α-helix | 209-213 | 5 | |
| α-helix | 217-220 | 4 | |
| β-strand | 223-226 | 4 | 4 |
| β-strand | 232-234 | 3 | 4 |
| α-helix | 238-240 | 3 | |
| β-strand | 244-247 | 4 | 4 |
| β-strand | 250-254 | 5 | 2 |
| α-helix | 260-274 | 15 | |
| β-strand | 301-304 | 4 | 2 |
| α-helix | 305-306 | 2 | |
| α-helix | 311-315 | 5 | |
| α-helix | 317-328 | 12 | |
| β-strand | 342-346 | 5 | 5 |
| α-helix | 349-362 | 14 | |
| β-strand | 366-370 | 5 | 5 |
| α-helix | 374-383 | 10 | |
| β-strand | 388 | 1 | 5 |
| β-strand | 389-391 | 3 | 6 |
| α-helix | 393-401 | 9 | |
| β-strand | 405-411 | 7 | 6 |
| β-strand | 427-433 | 7 | 7 |
| β-strand | 440 | 1 | 8 |
| β-strand | 443 | 1 | 8 |
| β-strand | 449-451 | 3 | 7 |
| α-helix | 457-461 | 5 | |
| α-helix | 462-471 | 10 | |
| α-helix | 476-478 | 3 | |
| β-strand | 483-484 | 2 | 7 |
| α-helix | 493-495 | 3 | |
| α-helix | 516-526 | 11 | |
| β-strand | 530-534 | 5 | 7 |
| α-helix | 537-540 | 4 | |
| α-helix | 549-552 | 4 | |
| α-helix | 556-558 | 3 | |
| β-strand | 559-562 | 4 | 7 |
| β-strand | 568-570 | 3 | 7 |
| α-helix | 574-576 | 3 | |
| β-strand | 580-581 | 2 | 7 |
| β-strand | 586-589 | 4 | 6 |
| α-helix | 591-593 | 3 | |
| α-helix | 594-606 | 13 | |
| β-strand | 637-639 | 3 | 6 |
| α-helix | 640 | 1 | |
| α-helix | 647-651 | 5 | |
| α-helix | 653-663 | 11 | |
| α-helix | 669-677 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serotransferrin | A | protein | 679 | Homo sapiens | P02787 (AlphaFold model) |
>28MR_1 Serotransferrin (chains A) VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAV TLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHT GLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCS TLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKD CHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAH GFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKPVKWCALSHHERLKCDEWSV NSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCED TPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFF SEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQ NTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKI LRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVG NLRKCSTSSLLEACTFRRP
Water and common crystallization additives (GOL, ACT, CL) are not listed.
Ru and Rh binding sites in the structure of human serum transferrin with Fe 3+ bound at the C-lobe. Banneville, A.S., Ferraro, G., D'Elia, R. et al. Dalton Trans (2026) 55:4051-4056. DOI 10.1039/d6dt00205f · PubMed
Other PDB entries of the same protein (UniProt P02787 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 28MR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.