29QJ: Fusion glycoprotein F1

Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex with Double stapled peptide 4/4g. Determined by X-ray diffraction at 1.32 Å resolution. Released 10 Jun 2026.

Method: X-ray diffraction
Resolution: 1.32 Å
Organisms: Human respiratory syncytial virus A, human respiratory syncytial virus
Chains: 2
Atoms: 614
Mol. weight: 8.03 kDa
Released: 10 Jun 2026

Explore 29QJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

29QJ contains 3 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	160-198	39
α-helix	199-203	5

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	498-513	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F1	A	protein	53	Human respiratory syncytial virus A	P03420
Double stapled peptide 4/4g	D	protein	22	human respiratory syncytial virus

Sequence of entity 1 (A), FASTA

>29QJ_1 Fusion glycoprotein F1 (chains A)
XHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKX

Sequence of entity 2 (D), FASTA

>29QJ_2 Double stapled peptide 4/4g (chains D)
XEKILQSLLFIRLSDELLHNVX

Primary citation

Double-Stapled Peptide Scan Yields Potent Fusion Inhibitors of Respiratory Syncytial Virus. Pidoux, N., Roh, L., Nicolet, N. et al. J Med Chem (2026) 69:12910-12924. DOI 10.1021/acs.jmedchem.5c02932 · PubMed

Other PDB entries of the same protein (UniProt P03420), best resolution first:

6OJ7 1.45 Å, Respiratory syncytial virus fusion glycoprotein N-terminal heptad repeat domain+VIQKI…
3KPE 1.47 Å, Solution structure of the respiratory syncytial virus (RSV)six-helix bundle complexed…
9RA5 1.63 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
3O41 1.95 Å, Crystal Structure of 101F Fab Bound to 15-mer Peptide Epitope
9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
6VKE 2.1 Å, Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein
7LVW 2.1 Å, Structure of RSV F in Complex with VHH Cl184
6NTX 2.2 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain+VIQKI
8DG9 2.24 Å, Cryo-EM Structure of RSV prefusion F trimer in complex with three MxR Fabs
8PHI 2.29 Å, Crystal structure of prefusion-stabilized RSV F Variant DS-Cav1 in complex with Lonafarnib
5C69 2.3 Å, Crystal Structure of Prefusion-stabilized RSV F variant PR-DM
5EA4 2.3 Å, Crystal Structure of Inhibitor JNJ-49153390 in Complex with Prefusion RSV F Glycoprotein

Browse structure collections

About this viewer

MolViewer shows 29QJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.