6OJ7: Fusion glycoprotein F0
Respiratory syncytial virus fusion glycoprotein N-terminal heptad repeat domain+VIQKI I456F. Determined by X-ray diffraction at 1.45 Å resolution. Released 5 Feb 2020.
- Method
- X-ray diffraction
- Resolution
- 1.45 Å
- Organisms
- Human respiratory syncytial virus A, Human respirovirus 3
- Chains
- 2
- Atoms
- 711
- Mol. weight
- 9.79 kDa
- Released
- 5 Feb 2020
Explore 6OJ7 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6OJ7 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 160-203 | 44 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 453-482 | 30 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Fusion glycoprotein F0 | A | protein | 53 | Human respiratory syncytial virus A | P03420 |
| Fusion glycoprotein F0 | C | protein | 38 | Human respirovirus 3 | P06828 |
Sequence of entity 1 (A), FASTA
>6OJ7_1 Fusion glycoprotein F0 (chains A)
XHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKX
Sequence of entity 2 (C), FASTA
>6OJ7_2 Fusion glycoprotein F0 (chains C)
XVALDPIDFSIVLNKIKSQLEESKEWIRRSNKILDSIX
Primary citation
Structure-Guided Improvement of a Dual HPIV3/RSV Fusion Inhibitor. Outlaw, V.K., Lemke, J.T., Zhu, Y. et al. J Am Chem Soc (2020) 142:2140-2144. DOI 10.1021/jacs.9b11548 · PubMed
Other PDB entries of the same protein (UniProt P03420), best resolution first:
- 29QJ 1.32 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
- 3KPE 1.47 Å, Solution structure of the respiratory syncytial virus (RSV)six-helix bundle complexed…
- 9RA5 1.63 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
- 3O41 1.95 Å, Crystal Structure of 101F Fab Bound to 15-mer Peptide Epitope
- 9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
- 6VKE 2.1 Å, Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein
- 7LVW 2.1 Å, Structure of RSV F in Complex with VHH Cl184
- 6NTX 2.2 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain+VIQKI
- 8DG9 2.24 Å, Cryo-EM Structure of RSV prefusion F trimer in complex with three MxR Fabs
- 8PHI 2.29 Å, Crystal structure of prefusion-stabilized RSV F Variant DS-Cav1 in complex with Lonafarnib
- 5C69 2.3 Å, Crystal Structure of Prefusion-stabilized RSV F variant PR-DM
- 5EA4 2.3 Å, Crystal Structure of Inhibitor JNJ-49153390 in Complex with Prefusion RSV F Glycoprotein
Browse structure collections
About this viewer
MolViewer shows 6OJ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.