7LVW: RSV F

Structure of RSV F in Complex with VHH Cl184. Determined by X-ray diffraction at 2.1 Å resolution. Released 24 Mar 2021.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Respiratory syncytial virus, Lama glama
Chains: 12
Atoms: 30,677
Mol. weight: 434.74 kDa
Ligands: NAG
Released: 24 Mar 2021

Explore 7LVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LVW contains 150 α-helices and 258 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	1
β-strand	38-49	12	1
β-strand	51-60	10	2
α-helix	74-97	24
α-helix	139-141	3
β-strand	144	1	3
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	2
α-helix	182-184	3
β-strand	186-194	9	2
α-helix	195-196	2
α-helix	197-203	7
α-helix	204-206	3
β-strand	208	1	4
β-strand	213	1	4
α-helix	217-239	23
β-strand	243-244	2	2
α-helix	247-248	2
α-helix	254-262	9
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	2
β-strand	296-305	10	2
β-strand	308-318	11	1
β-strand	321-322	2	5
β-strand	333-336	4	5
β-strand	340-345	6	1
β-strand	348-352	5	1
β-strand	359-361	3	1
β-strand	364-368	5	1
α-helix	369-371	3
β-strand	373-375	3	1
α-helix	377-380	4
α-helix	381-384	4
β-strand	394-398	5	5
β-strand	404-407	4	6
β-strand	411-416	6	6
β-strand	422-426	5	7
β-strand	430-434	5	7
α-helix	435-436	2
β-strand	438-443	6	6
β-strand	449-452	4	7
β-strand	455-458	4	7
α-helix	459-460	2
β-strand	465-469	5	1
α-helix	474-477	4
β-strand	487-491	5	5
α-helix	492-515	24
α-helix	516-518	3
β-strand	519	1	8
β-strand	521	1	9
α-helix	522-524	3
β-strand	530-533	4	10
β-strand	536-539	4	10
α-helix	540-542	3

Chain B: 24 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	14
α-helix	34-36	3
β-strand	38-49	12	14
β-strand	51-60	10	15
α-helix	74-97	24
α-helix	138-141	4
β-strand	144	1	6
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	15
β-strand	186-194	9	15
α-helix	195-197	3
α-helix	198-203	6
α-helix	204-206	3
β-strand	208	1	16
β-strand	213	1	16
α-helix	218-238	21
β-strand	243-244	2	15
α-helix	247-248	2
α-helix	254-261	8
α-helix	268-276	9
α-helix	278-283	6
β-strand	286-293	8	15
β-strand	296-305	10	15
β-strand	308-318	11	14
β-strand	321-322	2	17
β-strand	333-336	4	17
β-strand	340-345	6	14
β-strand	348-352	5	14
α-helix	355-357	3
β-strand	359-361	3	14
β-strand	364-368	5	14
α-helix	369-371	3
β-strand	373-375	3	14
α-helix	377-383	7
β-strand	394-398	5	17
β-strand	404-407	4	18
β-strand	411-416	6	18
β-strand	422-425	4	19
β-strand	431-434	4	19
β-strand	438-443	6	18
β-strand	449-452	4	19
β-strand	455-458	4	19
α-helix	459-460	2
β-strand	465-469	5	14
α-helix	474-477	4
α-helix	480-482	3
β-strand	490-491	2	17
α-helix	492-516	25
β-strand	519	1	9
β-strand	521	1	20
α-helix	522-524	3
β-strand	530-533	4	10
β-strand	536-539	4	10
α-helix	541-544	4
α-helix	545	1
β-strand	546	1	21
α-helix	547-548	2

Chain C: 23 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	22
β-strand	38-49	12	22
β-strand	51-60	10	23
β-strand	70	1	24
α-helix	74-97	24
α-helix	138-141	4
β-strand	144	1	25
α-helix	149-159	11
α-helix	163-170	8
β-strand	176-182	7	23
β-strand	185-194	10	23
α-helix	195-198	4
α-helix	199-203	5
α-helix	204-207	4
β-strand	211	1	24
α-helix	212-216	5
α-helix	217-238	22
β-strand	243-244	2	23
α-helix	247-248	2
α-helix	254-262	9
α-helix	268-275	8
α-helix	278-283	6
β-strand	286-293	8	23
β-strand	296-305	10	23
β-strand	308-318	11	22
β-strand	321-322	2	26
β-strand	333-336	4	26
β-strand	340-345	6	22
β-strand	348-352	5	22
α-helix	355-357	3
β-strand	359-361	3	22
β-strand	364-368	5	22
α-helix	369-371	3
β-strand	373-375	3	22
α-helix	377-383	7
β-strand	394-398	5	26
β-strand	404-407	4	27
β-strand	411-416	6	27
β-strand	422-426	5	28
β-strand	430-434	5	28
α-helix	435-436	2
β-strand	438-443	6	27
β-strand	449-452	4	28
β-strand	455-458	4	28
α-helix	459-460	2
β-strand	465-469	5	22
α-helix	474-477	4
β-strand	490-491	2	26
α-helix	492-517	26
α-helix	519-520	2
β-strand	521	1	29
α-helix	522-524	3
β-strand	530-533	4	30
β-strand	536-539	4	30
α-helix	541-544	4
β-strand	549	1	31

Chain D: 21 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	32
β-strand	38-60	23	32
α-helix	74-97	24
α-helix	138-141	4
β-strand	144	1	18
α-helix	149-159	11
α-helix	163-170	8
β-strand	176-180	5	32
β-strand	186-194	9	32
α-helix	195-197	3
α-helix	198-203	6
α-helix	217-239	23
β-strand	243-244	2	32
α-helix	247-248	2
α-helix	254-261	8
α-helix	268-275	8
α-helix	278-283	6
β-strand	286-293	8	32
β-strand	296-318	23	32
β-strand	321-322	2	33
β-strand	333-336	4	33
β-strand	340-345	6	32
β-strand	348-352	5	32
α-helix	355-357	3
β-strand	359-361	3	32
β-strand	364-368	5	32
α-helix	369-371	3
β-strand	373-375	3	32
α-helix	377-383	7
β-strand	394-398	5	33
β-strand	404-407	4	3
β-strand	411-416	6	3
β-strand	422-426	5	34
β-strand	430-434	5	34
α-helix	435-436	2
β-strand	438-443	6	3
β-strand	449-452	4	34
β-strand	455-458	4	34
α-helix	459-460	2
β-strand	465-469	5	32
α-helix	474-477	4
β-strand	490-491	2	33
α-helix	492-517	26
β-strand	519	1	20
α-helix	520	1
β-strand	521	1	8
α-helix	522-524	3
β-strand	530-533	4	10
β-strand	536-539	4	10
α-helix	541-544	4
β-strand	549	1	21

Chain E: 22 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	35
β-strand	38-60	23	35
α-helix	74-96	23
α-helix	138-141	4
β-strand	144	1	27
α-helix	149-157	9
α-helix	163-170	8
β-strand	176-180	5	35
α-helix	181	1
β-strand	186-194	9	35
α-helix	195-198	4
α-helix	199-203	5
α-helix	204-206	3
β-strand	208	1	36
β-strand	213	1	36
α-helix	218-239	22
β-strand	243-244	2	35
α-helix	247-248	2
α-helix	254-261	8
α-helix	268-275	8
α-helix	278-283	6
β-strand	286-293	8	35
β-strand	296-318	23	35
β-strand	321-322	2	37
β-strand	333-336	4	37
β-strand	340-345	6	35
β-strand	348-352	5	35
α-helix	355-357	3
β-strand	359-361	3	35
β-strand	364-368	5	35
α-helix	369-371	3
β-strand	373-375	3	35
α-helix	377-380	4
α-helix	381-384	4
β-strand	394-398	5	37
β-strand	404-407	4	38
β-strand	411-416	6	38
β-strand	422-426	5	39
β-strand	430-434	5	39
β-strand	438-443	6	38
β-strand	449-452	4	39
β-strand	455-458	4	39
α-helix	459-460	2
β-strand	465-469	5	35
α-helix	474-477	4
β-strand	487-491	5	37
α-helix	492-515	24
β-strand	519	1	29
β-strand	521	1	40
α-helix	522-524	3
β-strand	530-533	4	30
β-strand	536-539	4	30
α-helix	540-543	4

Chain F: 23 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	41
β-strand	38-60	23	41
α-helix	74-98	25
α-helix	138-141	4
β-strand	144	1	38
α-helix	149-158	10
α-helix	163-173	11
β-strand	176-180	5	41
β-strand	186-194	9	41
α-helix	195-197	3
α-helix	198-203	6
α-helix	217-238	22
β-strand	243-244	2	41
α-helix	247-248	2
α-helix	254-263	10
α-helix	268-275	8
α-helix	278-284	7
β-strand	286-293	8	41
β-strand	296-318	23	41
β-strand	321-322	2	42
β-strand	333-336	4	42
β-strand	340-345	6	41
β-strand	348-352	5	41
α-helix	355-357	3
β-strand	359-361	3	41
β-strand	364-368	5	41
α-helix	369-371	3
β-strand	373-375	3	41
α-helix	377-383	7
β-strand	394-398	5	42
β-strand	404-407	4	25
β-strand	411-416	6	25
β-strand	422-426	5	43
β-strand	430-434	5	43
α-helix	435-436	2
β-strand	438-443	6	25
β-strand	449-452	4	43
β-strand	455-458	4	43
α-helix	459-460	2
β-strand	465-469	5	41
α-helix	474-477	4
α-helix	480-482	3
β-strand	490-491	2	42
α-helix	492-516	25
β-strand	519	1	40
α-helix	522-524	3
β-strand	530-533	4	30
β-strand	536-539	4	30
α-helix	540-544	5
α-helix	545	1
β-strand	546	1	31
α-helix	547-548	2

Chain G: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	11
β-strand	11-13	3	12
β-strand	18-25	8	11
β-strand	33-39	7	13
β-strand	46-51	6	13
β-strand	57-59	3	13
α-helix	61-63	3
β-strand	67-71	5	11
β-strand	77-82	6	11
α-helix	84-86	3
β-strand	88-95	8	13
α-helix	100c-100e	3
β-strand	102-103	2	13
β-strand	107-109	3	13
β-strand	110-112	3	12

Chain H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	52
β-strand	11-13	3	53
β-strand	18-25	8	52
β-strand	33-39	7	54
β-strand	46-51	6	54
β-strand	57-59	3	54
β-strand	67-71	5	52
β-strand	77-82	6	52
α-helix	84-86	3
β-strand	88-95	8	54
α-helix	100c-100e	3
β-strand	102-103	2	54
β-strand	107-109	3	54
β-strand	110-112	3	53

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F0	A, B, C, D, E, F	protein	500	Respiratory syncytial virus	P03420
F-VHH-Cl184	G, H, I, J, K, L	protein	152	Lama glama

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>7LVW_1 Fusion glycoprotein F0 (chains A, B, C, D, E, F)
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKEIKCNGTDAKVKLIKQELDK
YKNAVTELQLLMQSTPATNNRARRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALL
STNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIETVIEFQQKNNRLLE
ITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSII
KEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFF
PQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGA
IVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGE
PIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVR
KDGEWVLLSTFLGSLEVLFQ

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>7LVW_2 F-VHH-Cl184 (chains G, H, I, J, K, L)
MRPTWAWWLFLVLLLALWAPARGQVQLQESGGGLVQAGGSLRLSCAASGQTFSGYVTGWF
RQAPGKEREFVALIAWSGGRLYYADSVQGRFTISRDNAETTVYLQMNSLKPEDTAVYYCA
AKRGGAVTAAEWYDYWGQGTQVTVSSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Water and common crystallization additives (CL) are not listed.

Primary citation

A vulnerable, membrane-proximal site in human respiratory syncytial virus F revealed by a prefusion-specific single-domain antibody. Rossey, I., Hsieh, C.L., Sedeyn, K. et al. J Virol (2021) 95. DOI 10.1128/JVI.02279-20 · PubMed

Other PDB entries of the same protein (UniProt P03420), best resolution first:

29QJ 1.32 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
6OJ7 1.45 Å, Respiratory syncytial virus fusion glycoprotein N-terminal heptad repeat domain+VIQKI…
3KPE 1.47 Å, Solution structure of the respiratory syncytial virus (RSV)six-helix bundle complexed…
9RA5 1.63 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
3O41 1.95 Å, Crystal Structure of 101F Fab Bound to 15-mer Peptide Epitope
9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
6VKE 2.1 Å, Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein
6NTX 2.2 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain+VIQKI
8DG9 2.24 Å, Cryo-EM Structure of RSV prefusion F trimer in complex with three MxR Fabs
8PHI 2.29 Å, Crystal structure of prefusion-stabilized RSV F Variant DS-Cav1 in complex with Lonafarnib
5C69 2.3 Å, Crystal Structure of Prefusion-stabilized RSV F variant PR-DM
5EA4 2.3 Å, Crystal Structure of Inhibitor JNJ-49153390 in Complex with Prefusion RSV F Glycoprotein

Browse structure collections

About this viewer

MolViewer shows 7LVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.