2A0L: KvAP-33H1 Fv complex

Crystal structure of KvAP-33H1 Fv complex. Determined by X-ray diffraction at 3.9 Å resolution. Released 1 Nov 2005.

Method: X-ray diffraction
Resolution: 3.9 Å
Organisms: Aeropyrum pernix, Mus musculus
Chains: 6
Atoms: 6,744
Mol. weight: 101.33 kDa
Released: 1 Nov 2005

Explore 2A0L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A0L contains 20 α-helices and 48 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	26-48	23
α-helix	54-67	14
α-helix	85-88	4
α-helix	104-111	8
α-helix	116-137	22
α-helix	149-172	24
α-helix	183-194	12
α-helix	207-235	29

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	26-48	23
α-helix	56-67	12
α-helix	85-88	4
α-helix	104-111	8
α-helix	116-137	22
α-helix	149-172	24
α-helix	183-194	12
α-helix	207-235	29

Chain C: 0 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
β-strand	10-11	2	2
β-strand	22-24	3	1
β-strand	35-39	5	3
β-strand	46-50	5	3
β-strand	54-55	2	3
β-strand	66-68	3	1
β-strand	71-73	3	1
β-strand	86-90	5	3
β-strand	91-92	2	4
β-strand	96-97	2	4
β-strand	102	1	3
β-strand	103-104	2	2

Chains D and F: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	5
α-helix	17	1
β-strand	18-25	8	5
β-strand	34-40	7	6
β-strand	46-53	8	6
β-strand	58-60	3	6
α-helix	64-67	4
β-strand	68-72	5	5
β-strand	78-83	6	5
β-strand	92-94	3	6
β-strand	96-100	5	6
β-strand	104-108	5	6
β-strand	112-114	3	6

Chain E: 0 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	7
β-strand	10-11	2	8
β-strand	22-24	3	7
β-strand	35-39	5	9
β-strand	46-50	5	9
β-strand	55	1	9
β-strand	66-68	3	7
β-strand	71-73	3	7
β-strand	86-90	5	9
β-strand	91-92	2	10
β-strand	96-97	2	10
β-strand	102	1	9
β-strand	103-104	2	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-gated potassium channel	A, B	protein	241	Aeropyrum pernix	Q9YDF8 (AlphaFold model)
33H1 Fv fragment	C, E	protein	105	Mus musculus
33H1 Fv fragment	D, F	protein	116	Mus musculus

Sequence of entity 1 (A, B), FASTA

>2A0L_1 Voltage-gated potassium channel (chains A, B)
LGLSDLGGRVRNIGDVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLIL
VIILWADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFL
RILLIISRGSKFLSAIADAADKIRFYHLFGAVMLTVLYGAFAIYIVEYPDPNSSIKSVFD
ALWWAVVTATTVGYGDVVPATPIGKVIGIAVMLTGISALTLLIGTVSNMFQKILVGEPEP
S

Sequence of entity 2 (C, E), FASTA

>2A0L_2 33H1 Fv fragment (chains C, E)
QIVLTQSPAIMSASLGDRVTMTCTASSSVSSSYLHWYQQKPGSSPKLWIYSTSNLASGVP
ARFSGSGSGTSYSLTISSMEAEDAATYYCHQFHRSLTFGSGTKLE

Sequence of entity 3 (D, F), FASTA

>2A0L_3 33H1 Fv fragment (chains D, F)
DVQLQESGPGLVKPSQSLSLTCTVTGYSITNNYAWNWIRQFPGNKLEWMGYINYSGTTSY
NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYFCVRGYDYFAMDYWGQGTSVTV

Primary citation

Structure of the KvAP voltage-dependent K+ channel and its dependence on the lipid membrane. Lee, S.Y., Lee, A., Chen, J. et al. Proc Natl Acad Sci U S A (2005) 102:15441-15446. DOI 10.1073/pnas.0507651102 · PubMed

Other PDB entries of the same protein (UniProt Q9YDF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ORS 1.9 Å, X-ray structure of the KvAP potassium channel voltage sensor in complex with an Fab
1ORQ 3.2 Å, X-ray structure of a voltage-dependent potassium channel in complex with an Fab
6UWM 5.9 Å, Single particle cryo-EM structure of KvAP
2KYH Solution structure of the voltage-sensing domain of KvAP

Browse structure collections

About this viewer

MolViewer shows 2A0L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.