6UWM: Single particle cryo-EM structure of KvAP

Single particle cryo-EM structure of KvAP. Determined by electron microscopy at 5.9 Å resolution. Released 4 Dec 2019.

Method: Electron microscopy
Resolution: 5.9 Å
Organism: Aeropyrum pernix
Chains: 4
Atoms: 6,828
Mol. weight: 126.6 kDa
Released: 4 Dec 2019

Explore 6UWM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UWM contains 32 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	25-45	21
α-helix	52-76	25
α-helix	84-97	14
α-helix	100-113	14
α-helix	116-145	30
α-helix	153-172	20
α-helix	185-194	10
α-helix	207-238	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-gated potassium channel	A, B, C, D	protein	287	Aeropyrum pernix	Q9YDF8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6UWM_1 Voltage-gated potassium channel (chains A, B, C, D)
MAGGRVRNIGDVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIIL
WADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILL
IISRGSKFLSAIADAADKIRFYHLFGAVMLTVLYGAFAIYIVEYPDPNSSIKSVFDALWW
AVVTATTVGYGDVVPATPIGKVIGIAVMLTGISALTLLIGTVSNMFQKILVGEPEPSSSP
AKLAEMVSSMSEEEFEEFVRTLKNLRRLENSMKLVPRGSRSHHHHHH

Primary citation

Cryo-EM structure of the KvAP channel reveals a non-domain-swapped voltage sensor topology. Tao, X., MacKinnon, R. Elife (2019) 8. DOI 10.7554/eLife.52164 · PubMed

Other PDB entries of the same protein (UniProt Q9YDF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ORS 1.9 Å, X-ray structure of the KvAP potassium channel voltage sensor in complex with an Fab
1ORQ 3.2 Å, X-ray structure of a voltage-dependent potassium channel in complex with an Fab
2A0L 3.9 Å, Crystal structure of KvAP-33H1 Fv complex
2KYH Solution structure of the voltage-sensing domain of KvAP

Browse structure collections

About this viewer

MolViewer shows 6UWM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.