2KYH: Voltage-sensing domain of KvAP

Solution structure of the voltage-sensing domain of KvAP. Determined by solution NMR. Released 29 Sept 2010.

Method: Solution NMR
Organism: Aeropyrum pernix
Chains: 1
Atoms: 1,144
Mol. weight: 16.2 kDa
Released: 29 Sept 2010

Explore 2KYH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KYH contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	13-22	10
α-helix	25-47	23
α-helix	52-80	29
α-helix	83-89	7
α-helix	94-97	4
α-helix	100-113	14
α-helix	117-148	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-gated potassium channel	A	protein	147	Aeropyrum pernix	Q9YDF8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KYH_1 Voltage-gated potassium channel (chains A)
LRGLSDLGGRVRNIGDVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLI
LVIILWADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRF
LRILLIISRGSKFLSAIADAADKLVPR

Primary citation

Solution Structure and Phospholipid Interactions of the Isolated Voltage-Sensor Domain from KvAP. Butterwick, J.A., Mackinnon, R. J Mol Biol (2010) 403:591-606. DOI 10.1016/j.jmb.2010.09.012 · PubMed

Other PDB entries of the same protein (UniProt Q9YDF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ORS 1.9 Å, X-ray structure of the KvAP potassium channel voltage sensor in complex with an Fab
1ORQ 3.2 Å, X-ray structure of a voltage-dependent potassium channel in complex with an Fab
2A0L 3.9 Å, Crystal structure of KvAP-33H1 Fv complex
6UWM 5.9 Å, Single particle cryo-EM structure of KvAP

Browse structure collections

About this viewer

MolViewer shows 2KYH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.