2A9H: Voltage-gated potassium channel

NMR structural studies of a potassium channel / charybdotoxin complex. Determined by solution NMR. Released 10 Jan 2006.

Method: Solution NMR
Organism: Streptomyces lividans
Chains: 5
Atoms: 3,179
Mol. weight: 71.18 kDa
Released: 10 Jan 2006

Explore 2A9H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A9H contains 14 α-helices and 2 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	25-51	27
α-helix	62-73	12
α-helix	86-115	30

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	25-51	27
β-strand	55	1	1
β-strand	57	1	1
α-helix	62-73	12
α-helix	86-115	30

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	810-820	11
α-helix	833-835	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-gated potassium channel	A, B, C, D	protein	155	Streptomyces lividans	P0A334 (AlphaFold model)
charybdotoxin	E	protein	37		P13487 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2A9H_1 Voltage-gated potassium channel (chains A, B, C, D)
MSGSHHHHHHSSGIEGRGRLIKHMPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLV
IVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMV
AGITSYGLVFAAVATWFVGREQERRGHFVRHSEKA

Sequence of entity 2 (E), FASTA

>2A9H_2 charybdotoxin (chains E)
QFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

Primary citation

Nuclear magnetic resonance structural studies of a potassium channel-charybdotoxin complex. Yu, L., Sun, C., Song, D. et al. Biochemistry (2005) 44:15834-15841. DOI 10.1021/bi051656d · PubMed

Other PDB entries of the same protein (UniProt P0A334 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IH3 1.72 Å, Ion selectivity in a semi-synthetic K+ channel locked in the conductive conformation
1R3J 1.9 Å, potassium channel KcsA-Fab complex in high concentration of Tl+
2HVK 1.9 Å, crystal structure of the KcsA-Fab-TBA complex in high K+
1K4C 2.0 Å, Potassium Channel KcsA-Fab complex in high concentration of K+
2P7T 2.05 Å, Crystal Structure of KcsA mutant
6PA0 2.05 Å, Structure of the G77A mutant in Sodium Chloride
4MSW 2.06 Å, Y78 ester mutant of KcsA in high K+
6NFU 2.09 Å, Structure of the KcsA-G77A mutant or the 2,4-ion bound configuration of a K+ channel…
6NFV 2.13 Å, Structure of the KcsA-G77C mutant or the 2,4-ion bound configuration of a K+ channel…
2H8P 2.25 Å, Structure of a K channel with an amide to ester substitution in the selectivity filter
5VK6 2.25 Å, Open conformation of KcsA non-inactivating E71A mutant
5VKH 2.25 Å, Closed conformation of KcsA Y82A-F103A mutant

Browse structure collections

About this viewer

MolViewer shows 2A9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.