2A9U: Ubiquitin carboxyl-terminal hydrolase 8

Name: PDB 2A9U: Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8)
Published: 2005-08-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hydrolase

Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8). Determined by X-ray diffraction at 2.1 Å resolution. Released 16 Aug 2005.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,274
Mol. weight: 34.05 kDa
Released: 16 Aug 2005

Explore 2A9U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A9U contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	7-11	5
α-helix	17-21	5
α-helix	22-24	3
α-helix	28-30	3
α-helix	33-52	20
α-helix	56-73	18
α-helix	77-81	5
α-helix	83-90	8
α-helix	92-138	47

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	17-22	6
α-helix	28-30	3
α-helix	33-52	20
α-helix	56-73	18
α-helix	77-80	4
α-helix	83-90	8
α-helix	92-130	39

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase 8	A, B	protein	144	Homo sapiens	P40818 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2A9U_1 Ubiquitin carboxyl-terminal hydrolase 8 (chains A, B)
GSMPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEER
AYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEV
RKKLEEKDRQEEAQRLQQKRQETG

Primary citation

Amino-terminal Dimerization, NRDP1-Rhodanese Interaction, and Inhibited Catalytic Domain Conformation of the Ubiquitin-specific Protease 8 (USP8). Avvakumov, G.V., Walker, J.R., Xue, S. et al. J Biol Chem (2006) 281:38061-38070. DOI 10.1074/jbc.M606704200 · PubMed

Other PDB entries of the same protein (UniProt P40818 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6F09 1.59 Å, Binary complex of 14-3-3 zeta with ubiquitin specific protease 8 (USP8) pSer718 peptide
8ADM 1.7 Å, Ternary complex of 14-3-3 sigma, Usp8pS718 phosphopeptide and small molecule stabilizer
2GFO 2.0 Å, Structure of the Catalytic Domain of Human Ubiquitin Carboxyl-terminal Hydrolase 8
8XPN 2.1 Å, The Crystal Structure of USP8 from Biortus.
2GWF 2.3 Å, Structure of a USP8-NRDP1 complex
3N3K 2.6 Å, The catalytic domain of USP8 in complex with a USP8 specific inhibitor
8Y9A 3.1 Å, The Crystal Structure of USP8 from Biortus.
1WHB Solution structure of the Rhodanese-like domain in human ubiquitin specific protease 8…

Browse structure collections

About this viewer

MolViewer shows 2A9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.