8Y9A: USP8 from Biortus

The Crystal Structure of USP8 from Biortus. Determined by X-ray diffraction at 3.1 Å resolution. Released 6 Mar 2024.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,089
Mol. weight: 16.79 kDa
Released: 6 Mar 2024

Explore 8Y9A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Y9A contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	8-11	4
α-helix	17-21	5
α-helix	28-30	3
α-helix	33-53	21
α-helix	56-73	18
α-helix	77-81	5
α-helix	83-89	7
α-helix	94-127	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase 8	A	protein	142	Homo sapiens	P40818 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8Y9A_1 Ubiquitin carboxyl-terminal hydrolase 8 (chains A)
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEAQRLQQKRQETG

Primary citation

The Crystal Structure of USP8 from Biortus. Wang, F., Cheng, W., Lv, Z. et al. To be published.

Other PDB entries of the same protein (UniProt P40818 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6F09 1.59 Å, Binary complex of 14-3-3 zeta with ubiquitin specific protease 8 (USP8) pSer718 peptide
8ADM 1.7 Å, Ternary complex of 14-3-3 sigma, Usp8pS718 phosphopeptide and small molecule stabilizer
2GFO 2.0 Å, Structure of the Catalytic Domain of Human Ubiquitin Carboxyl-terminal Hydrolase 8
2A9U 2.1 Å, Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8)
8XPN 2.1 Å, The Crystal Structure of USP8 from Biortus.
2GWF 2.3 Å, Structure of a USP8-NRDP1 complex
3N3K 2.6 Å, The catalytic domain of USP8 in complex with a USP8 specific inhibitor
1WHB Solution structure of the Rhodanese-like domain in human ubiquitin specific protease 8…

Browse structure collections

About this viewer

MolViewer shows 8Y9A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.