Mineralocorticoid Receptor Double Mutant with Bound Cortisone. Determined by X-ray diffraction at 1.75 Å resolution. Released 26 Jul 2005.
Explore 2AAX in 3D Show helices and sheets RCSB PDB PDBe
2AAX contains 28 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 729-734 | 6 | |
| α-helix | 735-737 | 3 | |
| α-helix | 738-745 | 8 | |
| α-helix | 746-749 | 4 | |
| α-helix | 762-785 | 24 | |
| α-helix | 790-792 | 3 | |
| α-helix | 795-822 | 28 | |
| β-strand | 827-830 | 4 | 1 |
| β-strand | 833-835 | 3 | 1 |
| α-helix | 837-842 | 6 | |
| α-helix | 846-862 | 17 | |
| α-helix | 866-877 | 12 | |
| β-strand | 880-882 | 3 | 2 |
| α-helix | 889-906 | 18 | |
| α-helix | 914-947 | 34 | |
| α-helix | 949-952 | 4 | |
| α-helix | 958-972 | 15 | |
| β-strand | 976-978 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 729-734 | 6 | |
| α-helix | 736-737 | 2 | |
| α-helix | 738-745 | 8 | |
| α-helix | 746-751 | 6 | |
| α-helix | 762-785 | 24 | |
| α-helix | 790-792 | 3 | |
| α-helix | 795-822 | 28 | |
| β-strand | 827-830 | 4 | 3 |
| β-strand | 833-835 | 3 | 3 |
| α-helix | 837-842 | 6 | |
| α-helix | 846-862 | 17 | |
| α-helix | 866-877 | 12 | |
| β-strand | 880-882 | 3 | 4 |
| α-helix | 889-906 | 18 | |
| α-helix | 914-947 | 34 | |
| α-helix | 949-952 | 4 | |
| α-helix | 958-972 | 15 | |
| β-strand | 976-978 | 3 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mineralocorticoid receptor | A, B | protein | 275 | Homo sapiens | P08235 (AlphaFold model) |
>2AAX_1 Mineralocorticoid receptor (chains A, B) GSAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTL NRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLLSFALSWRSYKHTNSQFLYF APDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQ AAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
| ID | Name | Formula | Copies |
|---|---|---|---|
| PDN | 17,21-dihydroxypregna-1,4-diene-3,11,20-trione | C21 H26 O5 | 2 |
Water and common crystallization additives (SO4) are not listed.
A Ligand-mediated Hydrogen Bond Network Required for the Activation of the Mineralocorticoid Receptor. Bledsoe, R.K., Madauss, K.P., Holt, J.A. et al. J Biol Chem (2005) 280:31283-31293. DOI 10.1074/jbc.M504098200 · PubMed
Other PDB entries of the same protein (UniProt P08235 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2AAX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.