Mineralocorticoid receptor ligand-binding domain with compuond 2e. Determined by X-ray diffraction at 1.4 Å resolution. Released 21 Aug 2013.
Explore 3WFG in 3D Show helices and sheets RCSB PDB PDBe
3WFG contains 13 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 738-745 | 8 | |
| α-helix | 747-749 | 3 | |
| α-helix | 762-785 | 24 | |
| α-helix | 790-792 | 3 | |
| α-helix | 795-822 | 28 | |
| β-strand | 827-830 | 4 | 1 |
| β-strand | 833-835 | 3 | 1 |
| α-helix | 837-842 | 6 | |
| α-helix | 846-862 | 17 | |
| α-helix | 866-877 | 12 | |
| β-strand | 880-881 | 2 | 2 |
| α-helix | 889-909 | 21 | |
| α-helix | 911-913 | 3 | |
| α-helix | 917-947 | 31 | |
| α-helix | 949-952 | 4 | |
| α-helix | 958-972 | 15 | |
| β-strand | 977-978 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mineralocorticoid receptor | A | protein | 275 | Homo sapiens | P08235 (AlphaFold model) |
>3WFG_1 Mineralocorticoid receptor (chains A) GSAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTL NRLAGKQMIQVVKWAKVLPGFKNLPLEDQITLIQYSWMSLLSFALSWRSYKHTNSQFLYF APDLVFNEEKMHQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQ AAFEEMRTNYIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRES HALKVEFPAMLVEIISDQLPKVESGNVKPLYFHRK
| ID | Name | Formula | Copies |
|---|---|---|---|
| WFG | 6-[(2S)-4-(4-fluorophenyl)-2-methyl-5-oxo-2,5-dihydrofuran-3-yl]-2H-1,4-benzoxa… | C19 H14 F N O4 | 1 |
Water and common crystallization additives (EDO) are not listed.
Design, synthesis, and structure-activity relationships of dihydrofuran-2-one and dihydropyrrol-2-one derivatives as novel benzoxazin-3-one-based mineralocorticoid receptor antagonists. Hasui, T., Ohra, T., Ohyabu, N. et al. Bioorg Med Chem (2013) 21:5983-5994. DOI 10.1016/j.bmc.2013.07.043 · PubMed
Other PDB entries of the same protein (UniProt P08235 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.