2ADX: Thrombomodulin
Fifth egf-like domain of thrombomodulin (TMEGF5), NMR, minimized average structure. Determined by solution NMR. Released 24 Dec 1997.
- Method
- Solution NMR
- Organism
- Homo sapiens
- Chains
- 1
- Atoms
- 300
- Mol. weight
- 4.38 kDa
- Released
- 24 Dec 1997
Explore 2ADX in 3D
Show helices and sheets
RCSB PDB
PDBe
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Thrombomodulin | A | protein | 40 | Homo sapiens | P07204 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>2ADX_1 THROMBOMODULIN (chains A)
QMFCNQTACPADCDPNTQASCECPEGYILDDGFICTDIDE
Primary citation
Structure of the fifth EGF-like domain of thrombomodulin: An EGF-like domain with a novel disulfide-bonding pattern. Sampoli Benitez, B.A., Hunter, M.J., Meininger, D.P. et al. J Mol Biol (1997) 273:913-926. DOI 10.1006/jmbi.1997.1356 · PubMed
Other PDB entries of the same protein (UniProt P07204 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1DX5 2.3 Å, Crystal structure of the thrombin-thrombomodulin complex
- 5TO3 2.34 Å, Crystal structure of thrombin mutant W215A/E217A fused to EGF456 of thrombomodulin via a…
- 3GIS 2.4 Å, Crystal Structure of Na-free Thrombin in Complex with Thrombomodulin
- 1HLT 3.0 Å, The structure of a nonadecapeptide of the fifth egf domain of thrombomodulin complexed…
- 7T4R 3.3 Å, CryoEM structure of the HCMV Pentamer gH/gL/UL128/UL130/UL131A in complex with THBD and…
- 1ADX Fifth egf-like domain of thrombomodulin (TMEGF5), NMR, 14 structures
- 1DQB NMR structure of thrombomodulin EGF(4-5)
- 1EGT Thrombin-bound structure of an egf subdomain from human thrombomodulin determined by…
- 1FGD Epidermal growth factor (EGF) subdomain of human thrombomodulin (NMR, 11 structures)
- 1FGE Epidermal growth factor (EGF) subdomain of human thrombomodulin (NMR, 14 structures)
- 1TMR The structure of a 19 residue fragment from the C-loop of the fourth epidermal growth…
- 1ZAQ Fourth egf-like domain of thrombomodulin, NMR, 12 structures
Browse structure collections
About this viewer
MolViewer shows 2ADX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.