2AEF: MthK RCK Domain in Ca2+ bound form

Crystal Structures of the MthK RCK Domain in Ca2+ bound form. Determined by X-ray diffraction at 1.7 Å resolution. Released 25 Oct 2005.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Methanothermobacter thermautotrophicus
Chains: 2
Atoms: 3,878
Mol. weight: 51.91 kDa
Ligands: CA
Released: 25 Oct 2005

Explore 2AEF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AEF contains 25 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	117-121	5	1
α-helix	125-133	9
β-strand	138-143	6	1
α-helix	146-148	3
α-helix	149-154	6
β-strand	158-161	4	1
α-helix	167-172	6
β-strand	180-183	4	1
α-helix	188-201	14
β-strand	206-210	5	1
α-helix	214-216	3
α-helix	217-223	7
β-strand	227-229	3	1
α-helix	231-241	11
α-helix	247-256	10
β-strand	263-268	6	2
β-strand	273	1	3
β-strand	279	1	4
α-helix	280-283	4
α-helix	285-289	5
β-strand	292-298	7	2
β-strand	301-304	4	2
β-strand	311	1	4
β-strand	317-322	6	2
α-helix	324-334	11
β-strand	336	1	3

Chain B: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	118-121	4	5
α-helix	125-133	9
β-strand	139-143	5	5
α-helix	146-148	3
α-helix	149-154	6
β-strand	158-161	4	5
α-helix	167-172	6
β-strand	180-183	4	5
α-helix	188-201	14
β-strand	206-210	5	5
α-helix	214-216	3
α-helix	217-223	7
β-strand	227-229	3	5
α-helix	231-240	10
α-helix	247-255	9
β-strand	263-268	6	6
β-strand	279	1	7
α-helix	280-283	4
α-helix	285-289	5
α-helix	291	1
β-strand	292-298	7	6
β-strand	301-304	4	6
β-strand	311	1	7
β-strand	317-322	6	6
α-helix	324-333	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-gated potassium channel mthK	A, B	protein	234	Methanothermobacter thermautotrophicus	O27564 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2AEF_1 Calcium-gated potassium channel mthK (chains A, B)
MGLIDVAKSRHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTR
VSDLEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGAD
QVISPFVISGRLMSRSIDDGYEAMFVQDVLAEESTRRMVEVPIPEGSKLEGVSVLDADIH
DVTGVIIIGVGRGDELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISALVPR

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Structures of the MthK RCK Domain and the Effect of Ca2+ on Gating Ring Stability. Dong, J., Shi, N., Berke, I. et al. J Biol Chem (2005) 280:41716-41724. DOI 10.1074/jbc.M508144200 · PubMed

Other PDB entries of the same protein (UniProt O27564 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LDC 1.45 Å, High resolution open MthK pore structure crystallized in 100 mM K+
3LDD 1.45 Å, High resolution open MthK pore structure crystallized in 100 mM K+ and further soaked in…
6U9T 1.55 Å, Wild-type MthK pore in 50 mM K+
4HYO 1.65 Å, Crystal Structure of MthK Pore
6U9P 1.65 Å, Wild-type MthK pore in ~150 mM K+
4HZ3 1.7 Å, MthK pore crystallized in presence of TBSb
3OUS 1.75 Å, MthK channel pore T59A mutant
3R65 1.8 Å, MthK channel pore E92Q mutant
6U9Y 1.8 Å, Wild-type MthK pore in 11 mM K+
4L74 1.84 Å, Ca2+-bound MthK RCK domain at 1.9 Angstrom with single ligand
6U9Z 1.95 Å, Wild-type MthK pore in 6 mM K+
2AEJ 2.1 Å, Crystal Structures of the MthK RCK Domain in no Ca2+ bound form

Browse structure collections

About this viewer

MolViewer shows 2AEF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.