Human muscle aldolase. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Apr 1999.
Explore 2ALD in 3D Show helices and sheets RCSB PDB PDBe
2ALD contains 17 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-22 | 14 | |
| β-strand | 28-32 | 5 | 1 |
| α-helix | 36-45 | 10 | |
| α-helix | 52-63 | 12 | |
| α-helix | 67-69 | 3 | |
| β-strand | 73-78 | 6 | 1 |
| α-helix | 80-83 | 4 | |
| β-strand | 86 | 1 | 2 |
| β-strand | 92 | 1 | 2 |
| α-helix | 93-99 | 7 | |
| α-helix | 102 | 1 | |
| β-strand | 103-107 | 5 | 1 |
| β-strand | 112-114 | 3 | 3 |
| β-strand | 122-124 | 3 | 3 |
| α-helix | 130-139 | 10 | |
| β-strand | 144-151 | 8 | 1 |
| α-helix | 160-179 | 20 | |
| β-strand | 183-190 | 8 | 1 |
| α-helix | 198-218 | 21 | |
| α-helix | 223-225 | 3 | |
| β-strand | 227-228 | 2 | 1 |
| α-helix | 230-232 | 3 | |
| α-helix | 245-257 | 13 | |
| β-strand | 266-269 | 4 | 1 |
| α-helix | 276-288 | 13 | |
| β-strand | 296-301 | 6 | 1 |
| α-helix | 303-313 | 11 | |
| α-helix | 317-319 | 3 | |
| α-helix | 320-337 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fructose-bisphosphate aldolase | A | protein | 363 | Homo sapiens | P04075 (AlphaFold model) |
>2ALD_1 FRUCTOSE-BISPHOSPHATE ALDOLASE (chains A) PYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQ LLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNG ETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQN GIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACT QKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFS YGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSN HAY
Crystal structure of human muscle aldolase complexed with fructose 1,6-bisphosphate: mechanistic implications. Dalby, A., Dauter, Z., Littlechild, J.A. Protein Sci (1999) 8:291-297. PubMed
Other PDB entries of the same protein (UniProt P04075 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ALD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.