2AQL: MRG15 MRG domain

Crystal Structure of the MRG15 MRG domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Feb 2006.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,648
Mol. weight: 40.14 kDa
Released: 28 Feb 2006

Explore 2AQL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AQL contains 28 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	159-161	3
α-helix	162-164	3
α-helix	165-176	12
β-strand	180-182	3	1
β-strand	189	1	2
α-helix	190-200	11
α-helix	212-228	17
α-helix	236-238	3
α-helix	239-248	10
α-helix	254-256	3
β-strand	259	1	2
α-helix	260-274	15
α-helix	281-300	20
α-helix	302-305	4
α-helix	308-310	3
β-strand	311-313	3	1
α-helix	314-315	2
α-helix	316-319	4

Chain B: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	159-161	3
α-helix	162-164	3
α-helix	165-176	12
β-strand	180-182	3	3
β-strand	189	1	4
α-helix	190-200	11
α-helix	214-228	15
α-helix	236-238	3
α-helix	239-248	10
α-helix	254-256	3
β-strand	259	1	4
α-helix	260-268	9
α-helix	277-280	4
α-helix	281-300	20
α-helix	302-305	4
α-helix	308-310	3
β-strand	311-313	3	3
α-helix	314-315	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mortality factor 4-like protein 1	A, B	protein	173	Homo sapiens	Q9UBU8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2AQL_1 Mortality factor 4-like protein 1 (chains A, B)
MNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK
EYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRI
GAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV

Primary citation

Multipurpose MRG domain involved in cell senescence and proliferation exhibits structural homology to a DNA-interacting domain. Bowman, B.R., Moure, C.M., Kirtane, B.M. et al. Structure (2006) 14:151-158. DOI 10.1016/j.str.2005.08.019 · PubMed

Other PDB entries of the same protein (UniProt Q9UBU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F5J 2.2 Å, Crystal structure of MRG domain from human MRG15
2F5K 2.2 Å, Crystal structure of the chromo domain of human MRG15
6INE 2.6 Å, Crystal Structure of human ASH1L-MRG15 complex
7S4A 2.69 Å, MRG15 complex with PALB2 peptide
6AGO 3.1 Å, Crystal structure of MRG15-ASH1L Histone methyltransferase complex
8C60 3.4 Å, Cryo-EM structure of the human SIN3B full-length complex at 3.4 Angstrom resolution
8BPA 3.7 Å, Cryo-EM structure of the human SIN3B histone deacetylase complex at 3.7 Angstrom
2EFI Solution structure of the chromo domain of Mortality factor 4-like protein 1 from human
2LKM Structural Basis for Molecular Interactions Involving MRG Domains: Implications in…
2N1D Solution structure of the MRG15-MRGBP complex

Browse structure collections

About this viewer

MolViewer shows 2AQL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.