2ASS: Skp1-Skp2-Cks1 complex

Crystal structure of the Skp1-Skp2-Cks1 complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 18 Oct 2005.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,404
Mol. weight: 65.07 kDa
Ligands: PO4, BEN
Released: 18 Oct 2005

Explore 2ASS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ASS contains 24 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1003-1007	5	1
β-strand	1013-1017	5	1
α-helix	1018-1021	4
α-helix	1025-1032	8
β-strand	1039-1040	2	1
α-helix	1046-1058	13
α-helix	1087-1092	6
α-helix	1097-1110	14
α-helix	1113-1125	13
α-helix	1132-1138	7
α-helix	1150-1154	5

Chain B: 14 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	2102-2109	8
α-helix	2114-2120	7
α-helix	2128-2131	4
β-strand	2139-2141	3	2
β-strand	2146	1	3
α-helix	2149-2156	8
β-strand	2162-2164	3	2
β-strand	2169-2170	2	3
β-strand	2185-2187	3	2
β-strand	2192-2193	2	3
α-helix	2195-2202	8
β-strand	2210-2212	3	2
β-strand	2217	1	4
α-helix	2220-2226	7
β-strand	2234-2236	3	2
β-strand	2241	1	4
α-helix	2245-2254	10
β-strand	2260-2262	3	2
α-helix	2271-2280	10
β-strand	2287-2289	3	2
α-helix	2299-2308	10
β-strand	2314-2316	3	2
α-helix	2325-2327	3
α-helix	2328-2332	5
β-strand	2339-2341	3	2
α-helix	2350-2358	9
β-strand	2364-2366	3	2
α-helix	2376-2382	7
β-strand	2387-2388	2	2
β-strand	2408-2409	2	5
β-strand	2412-2413	2	5
α-helix	2414	1
β-strand	2416-2417	2	2

Chain C: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	3007-3008	2	6
β-strand	3012-3013	2	6
β-strand	3017-3023	7	6
α-helix	3029-3031	3
α-helix	3040-3046	7
β-strand	3055-3059	5	6
β-strand	3066-3072	7	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-phase kinase-associated protein 1A	A	protein	159	Homo sapiens	P63208 (AlphaFold model)
S-phase kinase-associated protein 2	B	protein	336	Homo sapiens	Q13309 (AlphaFold model)
Cyclin-dependent kinases regulatory subunit 1	C	protein	69	Homo sapiens	P61024 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ASS_1 S-phase kinase-associated protein 1A (chains A)
ASIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQW
CTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC

Sequence of entity 2 (B), FASTA

>2ASS_2 S-phase kinase-associated protein 2 (chains B)
RENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLH
PDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKL
QNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFD
FTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCF
QEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQI
NCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Sequence of entity 3 (C), FASTA

>2ASS_3 Cyclin-dependent kinases regulatory subunit 1 (chains C)
QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP
HILLFRRPL

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	3
BEN	Benzamidine	C7 H8 N2	2

Primary citation

Structural Basis of the Cks1-Dependent Recognition of p27(Kip1) by the SCF(Skp2) Ubiquitin Ligase. Hao, B., Zheng, N., Schulman, B.A. et al. Mol Cell (2005) 20:9-19. DOI 10.1016/j.molcel.2005.09.003 · PubMed

Other PDB entries of the same protein (UniProt P63208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FS1 1.8 Å, Insights into scf ubiquitin ligases from the structure of the SKP1-SKP2 complex
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
2AST 2.3 Å, Crystal structure of Skp1-Skp2-Cks1 in complex with a p27 peptide
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
2E31 2.4 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
2OVR 2.5 Å, Structure of the Skp1-Fbw7-CyclinEdegN complex
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex
6WNX 2.5 Å, FBXW11-SKP1 in complex with a pSer33/pSer37 Beta-Catenin peptide
5IBK 2.5 Å, Skp1-F-box in complex with a ubiquitin variant
6O60 2.5 Å, Crystal structure of GGTase3-FBXL2-SKP1 complex
5JH5 2.55 Å, Structural Basis for the Hierarchical Assembly of the Core of PRC1.1

Browse structure collections

About this viewer

MolViewer shows 2ASS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.