2AUK: E. coli RNA polymerase beta' G/G' insert

Structure of E. coli RNA polymerase beta' G/G' insert. Determined by X-ray diffraction at 2.3 Å resolution. Released 4 Oct 2005.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Escherichia coli
Chains: 5
Atoms: 7,306
Mol. weight: 100.68 kDa
Released: 4 Oct 2005

Explore 2AUK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AUK contains 28 α-helices and 110 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	10-12	3	1
β-strand	17-22	6	2
β-strand	26-28	3	1
β-strand	34-36	3	1
β-strand	42-46	5	2
β-strand	52-57	6	2
α-helix	62	1
β-strand	63-64	2	1
β-strand	71-72	2	2
β-strand	77-80	4	1
β-strand	85-89	5	3
β-strand	94-99	6	4
β-strand	103	1	3
β-strand	107-111	5	3
β-strand	118-122	5	3
α-helix	123-124	2
β-strand	138-142	5	4
β-strand	148	1	4
β-strand	150	1	5
β-strand	157	1	5
β-strand	159-161	3	4
β-strand	167-168	2	3
β-strand	175-176	2	4
β-strand	181-186	6	3

Chain B: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	6
β-strand	17-22	6	7
β-strand	26-28	3	6
β-strand	34-36	3	6
β-strand	41-46	6	7
β-strand	52-58	7	7
β-strand	63-64	2	6
β-strand	71-72	2	7
β-strand	77-80	4	6
β-strand	86-89	4	8
β-strand	94-99	6	9
β-strand	103	1	8
β-strand	107-111	5	8
β-strand	118-122	5	8
α-helix	123-124	2
α-helix	125-127	3
α-helix	130-134	5
β-strand	138-142	5	9
α-helix	147	1
β-strand	148	1	9
α-helix	149	1
β-strand	150	1	10
α-helix	151	1
β-strand	157	1	10
β-strand	159-161	3	9
β-strand	167-168	2	8
α-helix	171	1
β-strand	175-176	2	9
β-strand	181-185	5	8
α-helix	186-187	2

Chain C: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	11
β-strand	17-22	6	12
β-strand	26-28	3	11
β-strand	34-36	3	11
β-strand	42-46	5	12
β-strand	52-57	6	12
α-helix	62	1
β-strand	63-64	2	11
β-strand	71-72	2	12
β-strand	77-80	4	11
β-strand	85-89	5	13
β-strand	94-99	6	14
β-strand	103	1	13
β-strand	107-111	5	13
β-strand	118-122	5	13
α-helix	123-124	2
α-helix	125-127	3
α-helix	130-133	4
β-strand	138-142	5	14
α-helix	147	1
β-strand	148	1	14
α-helix	149	1
β-strand	150-151	2	15
β-strand	156-157	2	15
β-strand	159-161	3	14
β-strand	167-168	2	13
α-helix	171	1
β-strand	175-176	2	14
β-strand	181-186	6	13

Chain D: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	16
β-strand	17-22	6	17
β-strand	26-28	3	16
β-strand	34-36	3	16
β-strand	42-47	6	17
β-strand	52-57	6	17
α-helix	58-59	2
β-strand	63-64	2	16
β-strand	71-72	2	17
β-strand	77-80	4	16
β-strand	85-89	5	18
β-strand	94-99	6	19
β-strand	103	1	18
β-strand	107-110	4	18
β-strand	119-122	4	18
α-helix	123-124	2
β-strand	138-142	5	19
β-strand	148	1	19
β-strand	150	1	20
α-helix	151	1
β-strand	157	1	20
β-strand	159-161	3	19
β-strand	167-168	2	18
β-strand	175-176	2	19
β-strand	181-186	6	18
α-helix	187-188	2

Chain E: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	10-12	3	21
β-strand	17-22	6	22
β-strand	26-28	3	21
β-strand	34-36	3	21
β-strand	41-46	6	22
β-strand	52-58	7	22
β-strand	63-64	2	21
β-strand	71-72	2	22
β-strand	77-80	4	21
β-strand	86-89	4	23
β-strand	94-99	6	24
β-strand	103	1	23
β-strand	107-111	5	23
β-strand	118-122	5	23
α-helix	123-124	2
α-helix	125-127	3
β-strand	138-142	5	24
α-helix	147	1
β-strand	148	1	24
α-helix	149	1
β-strand	150	1	25
α-helix	151	1
β-strand	157	1	25
β-strand	159-161	3	24
β-strand	167-168	2	23
β-strand	175-176	2	24
β-strand	181-185	5	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase beta' chain	A, B, C, D, E	protein	190	Escherichia coli	P0A8T7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>2AUK_1 DNA-directed RNA polymerase beta' chain (chains A, B, C, D, E)
GSHMAAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPY
GAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSL
VVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGD
TLARIPQESG

Primary citation

Structure and Function of Lineage-specific Sequence Insertions in the Bacterial RNA Polymerase beta' Subunit. Chlenov, M., Masuda, S., Murakami, K.S. et al. J Mol Biol (2005) 353:138-154. DOI 10.1016/j.jmb.2005.07.073 · PubMed

Other PDB entries of the same protein (UniProt P0A8T7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IQZ 2.1 Å, The crystal structure of a large insert in RNA polymerase (RpoC) subunit from E. coli
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…
9YMV 2.6 Å, De novo initial transcribing RNA polymerase with pretranslocated 3-mer RNA / product…

Browse structure collections

About this viewer

MolViewer shows 2AUK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.