4IQZ: DNA-directed RNA polymerase subunit beta'

The crystal structure of a large insert in RNA polymerase (RpoC) subunit from E. coli. Determined by X-ray diffraction at 2.1 Å resolution. Released 13 Feb 2013.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Escherichia coli
Chains: 5
Atoms: 6,463
Mol. weight: 140.94 kDa
Released: 13 Feb 2013

Explore 4IQZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IQZ contains 33 α-helices and 108 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	38-40	3	1
β-strand	45-50	6	2
β-strand	54-56	3	1
β-strand	62-64	3	1
β-strand	70-74	5	2
β-strand	80-85	6	2
α-helix	90	1
β-strand	91-92	2	1
β-strand	99-100	2	2
β-strand	105-108	4	1
β-strand	113-117	5	3
β-strand	122-127	6	4
β-strand	131	1	3
β-strand	135-138	4	3
β-strand	147-150	4	3
α-helix	151-152	2
α-helix	153-155	3
α-helix	160-162	3
β-strand	166-170	5	4
α-helix	175	1
β-strand	176	1	4
α-helix	177	1
β-strand	178	1	5
α-helix	179	1
β-strand	185	1	5
β-strand	187-189	3	4
β-strand	195-196	2	3
α-helix	198-199	2
β-strand	203-204	2	4
β-strand	209-214	6	3

Chain B: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	38-40	3	6
β-strand	45-50	6	7
β-strand	54-56	3	6
β-strand	62-64	3	6
β-strand	69-74	6	7
β-strand	80-86	7	7
α-helix	90	1
β-strand	91-92	2	6
β-strand	99-100	2	7
β-strand	105-108	4	6
β-strand	113-117	5	8
β-strand	122-127	6	9
β-strand	131	1	8
β-strand	135-139	5	8
β-strand	146-150	5	8
α-helix	151-152	2
α-helix	160-162	3
β-strand	166-170	5	9
α-helix	175	1
β-strand	176	1	9
α-helix	177	1
β-strand	178	1	10
α-helix	179	1
β-strand	185	1	10
β-strand	187-189	3	9
β-strand	195-196	2	8
α-helix	199	1
β-strand	203-204	2	9
β-strand	209-214	6	8

Chain C: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	38-40	3	11
β-strand	45-50	6	12
β-strand	54-56	3	11
β-strand	62-64	3	11
β-strand	69-74	6	12
β-strand	80-86	7	12
α-helix	90	1
β-strand	91-92	2	11
β-strand	99-100	2	12
β-strand	105-108	4	11
β-strand	113-117	5	13
β-strand	122-127	6	14
β-strand	131	1	13
β-strand	135-137	3	13
β-strand	148-150	3	13
α-helix	151-152	2
α-helix	153-155	3
β-strand	166-170	5	14
α-helix	175	1
β-strand	176	1	14
α-helix	177	1
β-strand	178	1	15
α-helix	179	1
β-strand	185	1	15
β-strand	187-189	3	14
β-strand	195-196	2	13
α-helix	199	1
β-strand	203-204	2	14
β-strand	209-214	6	13

Chain D: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	38-40	3	16
β-strand	54-56	3	16
β-strand	62-64	3	16
β-strand	69-71	3	17
β-strand	84-86	3	17
α-helix	90	1
β-strand	91-92	2	16
β-strand	105-108	4	16
β-strand	113-117	5	18
β-strand	122-127	6	19
β-strand	131	1	18
β-strand	135-138	4	18
β-strand	147-150	4	18
β-strand	166-170	5	19
α-helix	175	1
β-strand	176	1	19
α-helix	177	1
β-strand	178	1	20
α-helix	179	1
β-strand	185	1	20
β-strand	187-189	3	19
β-strand	195-196	2	18
β-strand	203-204	2	19
β-strand	209-214	6	18

Chain E: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	38-40	3	21
β-strand	45-50	6	22
β-strand	54-56	3	21
β-strand	62-64	3	21
β-strand	69-74	6	22
β-strand	82-86	5	22
α-helix	90	1
β-strand	91-92	2	21
β-strand	99-100	2	22
β-strand	105-108	4	21
β-strand	113-117	5	23
β-strand	122-127	6	24
β-strand	131	1	23
β-strand	135-139	5	23
β-strand	146-150	5	23
α-helix	151-152	2
α-helix	153-155	3
α-helix	158-160	3
β-strand	166-170	5	24
α-helix	175	1
β-strand	176	1	24
α-helix	177	1
β-strand	178	1	25
β-strand	185	1	25
β-strand	187-189	3	24
β-strand	195-196	2	23
α-helix	199	1
β-strand	203-204	2	24
β-strand	209-214	6	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit beta'	A, B, C, D, E	protein	250	Escherichia coli	P0A8T7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>4IQZ_1 DNA-directed RNA polymerase subunit beta' (chains A, B, C, D, E)
MGSSHHHHHHSSGLVPRGSHMRTFHIGGAASRAAAESSIQVKNKGSIKLSNVKSVVNSSG
KLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEV
SGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIP
GTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPRMDPAANKARKE
AELAAATAEQ

Primary citation

The crystal structure of a large insert in RNA polymerase (RpoC) subunit from E. coli. Bhandari, V., Sugiman-Marangos, S.N., Naushad, H.S. et al. To be published.

Other PDB entries of the same protein (UniProt P0A8T7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
2AUK 2.3 Å, Structure of E. coli RNA polymerase beta' G/G' insert
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…
9YMV 2.6 Å, De novo initial transcribing RNA polymerase with pretranslocated 3-mer RNA / product…

Browse structure collections

About this viewer

MolViewer shows 4IQZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.