2AZE: Rb C-terminal domain

Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer. Determined by X-ray diffraction at 2.55 Å resolution. Released 31 Jan 2006.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,456
Mol. weight: 34.62 kDa
Released: 31 Jan 2006

Explore 2AZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AZE contains 15 α-helices and 11 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	199-245	47
α-helix	250-252	3
α-helix	253-255	3
β-strand	256-258	3	1
β-strand	262-267	6	2
β-strand	272-276	5	3
β-strand	282-287	6	3
β-strand	291-295	5	2
α-helix	296-302	7
α-helix	309-311	3
α-helix	316-324	9
α-helix	328-330	3
α-helix	331-339	9

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	202-236	35
α-helix	238-243	6
β-strand	245-247	3	1
α-helix	248-252	5
β-strand	260-266	7	2
α-helix	267-268	2
β-strand	272-277	6	3
β-strand	282-287	6	3
β-strand	294-296	3	2

Chain C: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	830-834	5	3
α-helix	841-853	13
α-helix	859-861	3
α-helix	868-870	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor Dp-1	A	protein	155	Homo sapiens	Q14186 (AlphaFold model)
Transcription factor E2F1	B	protein	106	Homo sapiens	Q01094 (AlphaFold model)
Retinoblastoma-associated protein	C	protein	46	Homo sapiens	P06400 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2AZE_1 Transcription factor Dp-1 (chains A)
GEFAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASRPPPPNS
VIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVLKRMGMACGLESGSCS
AEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTA

Sequence of entity 2 (B), FASTA

>2AZE_2 Transcription factor E2F1 (chains B)
GSHMGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIA
DPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEE

Sequence of entity 3 (C), FASTA

>2AZE_3 Retinoblastoma-associated protein (chains C)
SRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKK

Primary citation

Structure of the Rb C-terminal domain bound to E2F1-DP1: a mechanism for phosphorylation-induced E2F release. Rubin, S.M., Gall, A.L., Zheng, N. et al. Cell (2005) 123:1093-1106. DOI 10.1016/j.cell.2005.09.044 · PubMed

Other PDB entries of the same protein (UniProt Q14186 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TUU 2.25 Å, Crystal structure of the E2F4-DP1 coiled coil and marked-box domains
5TUV 2.9 Å, Crystal structure of the E2F5-DP1-p107 ternary complex
5GOW Solution structure of the complex between DP1 acidic region and TFIIH p62 PH domain

Browse structure collections

About this viewer

MolViewer shows 2AZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.