5GOW: DP1

Name: PDB 5GOW: Solution structure of the complex between DP1 acidic region and TFIIH p62 PH domain
Published: 2016-12-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution structure of the complex between DP1 acidic region and TFIIH p62 PH domain. Determined by solution NMR. Released 7 Dec 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,023
Mol. weight: 14.73 kDa
Released: 7 Dec 2016

Explore 5GOW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GOW contains 3 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	404-405	2	1

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	2
β-strand	15-16	2	1
β-strand	22-27	6	2
β-strand	30-35	6	2
β-strand	43-46	4	2
β-strand	50-56	7	1
α-helix	57	1
β-strand	58	1	3
β-strand	60	1	3
β-strand	63-69	7	1
β-strand	74-79	6	1
α-helix	85-99	15
α-helix	100-102	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DP1	A	protein	19	Homo sapiens	Q14186 (AlphaFold model)
General transcription factor IIH subunit 1	B	protein	110	Homo sapiens	P32780 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5GOW_1 DP1 (chains A)
YVGEDDEEDDDFNENDEDD

Sequence of entity 2 (B), FASTA

>5GOW_2 General transcription factor IIH subunit 1 (chains B)
GSMATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPE
GKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKAN

Primary citation

The Interaction Mode of the Acidic Region of the Cell Cycle Transcription Factor DP1 with TFIIH. Okuda, M., Araki, K., Ohtani, K. et al. J Mol Biol (2016) 428:4993-5006. DOI 10.1016/j.jmb.2016.11.001 · PubMed

Other PDB entries of the same protein (UniProt Q14186 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TUU 2.25 Å, Crystal structure of the E2F4-DP1 coiled coil and marked-box domains
2AZE 2.55 Å, Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer
5TUV 2.9 Å, Crystal structure of the E2F5-DP1-p107 ternary complex

Browse structure collections

About this viewer

MolViewer shows 5GOW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.