5TUV: E2F5-DP1-p107 ternary complex

Crystal structure of the E2F5-DP1-p107 ternary complex. Determined by X-ray diffraction at 2.9 Å resolution. Released 3 May 2017.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,532
Mol. weight: 70.46 kDa
Released: 3 May 2017

Explore 5TUV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TUV contains 14 α-helices and 26 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	200-244	45
β-strand	257-258	2	1
β-strand	261-266	6	2
β-strand	272-276	5	3
β-strand	283-287	5	3
β-strand	291-295	5	2
α-helix	296-302	7

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	127-162	36
α-helix	165-169	5
β-strand	172-173	2	1
α-helix	175-181	7
β-strand	186-191	6	2
β-strand	197-201	5	3
β-strand	205	1	4
β-strand	211	1	4
β-strand	213-218	6	3
β-strand	224-229	6	2

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1001-1005	5	3
α-helix	1011-1023	13

Chain D: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	209-243	35
β-strand	256-258	3	5
β-strand	262-266	5	3
β-strand	272-276	5	2
β-strand	282-287	6	2
β-strand	291-295	5	3
α-helix	296-301	6

Chain E: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	129-133	5
α-helix	136-161	26
α-helix	165-169	5
β-strand	172-174	3	5
α-helix	175-180	6
β-strand	186-191	6	3
β-strand	197-200	4	2
α-helix	202-203	2
β-strand	204	1	6
β-strand	212	1	6
β-strand	213-218	6	2
β-strand	224-230	7	3

Chain F: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1002-1005	4	2
α-helix	1012-1022	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor DP1	A, D	protein	155	Homo sapiens	Q14186 (AlphaFold model)
Transcription factor E2F5	B, E	protein	112	Homo sapiens	Q15329 (AlphaFold model)
Retinoblastoma-like protein 1	C, F	protein	41	Homo sapiens	P28749 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>5TUV_1 Transcription factor DP1 (chains A, D)
GEFAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASRPPPPNS
VIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVLKRMGMACGLESGSCS
AEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTA

Sequence of entity 2 (B, E), FASTA

>5TUV_2 Transcription factor E2F5 (chains B, E)
GHMKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICN
CFNGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKE

Sequence of entity 3 (C, F), FASTA

>5TUV_3 Retinoblastoma-like protein 1 (chains C, F)
GEFSGLTPRSALLYKFNGSPSKSLKDINNMIRQGEQRTKKR

Primary citation

Conservation and divergence of C-terminal domain structure in the retinoblastoma protein family. Liban, T.J., Medina, E.M., Tripathi, S. et al. Proc Natl Acad Sci U S A (2017) 114:4942-4947. DOI 10.1073/pnas.1619170114 · PubMed

Other PDB entries of the same protein (UniProt Q14186 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TUU 2.25 Å, Crystal structure of the E2F4-DP1 coiled coil and marked-box domains
2AZE 2.55 Å, Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer
5GOW Solution structure of the complex between DP1 acidic region and TFIIH p62 PH domain

Browse structure collections

About this viewer

MolViewer shows 5TUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.