2AZM: MDC1 brct repeat

Crystal structure of the MDC1 brct repeat in complex with the histone tail of gamma-H2AX. Determined by X-ray diffraction at 2.41 Å resolution. Released 31 Jan 2006.

Method: X-ray diffraction
Resolution: 2.41 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,432
Mol. weight: 48.24 kDa
Released: 31 Jan 2006

Explore 2AZM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AZM contains 30 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1894-1897	4	1
α-helix	1903-1911	9
β-strand	1915-1916	2	1
α-helix	1920-1922	3
β-strand	1925-1927	3	1
β-strand	1934	1	2
α-helix	1935-1943	9
β-strand	1947-1948	2	1
α-helix	1951-1959	9
α-helix	1962-1964	3
α-helix	1965-1968	4
β-strand	1969	1	1
α-helix	1973-1979	7
α-helix	1983-1992	10
β-strand	2000-2003	4	3
α-helix	2011-2020	10
β-strand	2024-2026	3	3
β-strand	2037-2040	4	3
α-helix	2043-2049	7
α-helix	2050-2055	6
α-helix	2057-2058	2
β-strand	2059-2060	2	3
α-helix	2063-2066	4
α-helix	2068-2071	4
α-helix	2076-2078	3
β-strand	2080	1	3
α-helix	2081-2082	2

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1894-1897	4	4
α-helix	1903-1911	9
β-strand	1915-1916	2	4
β-strand	1925-1927	3	4
α-helix	1935-1943	9
β-strand	1947-1948	2	4
α-helix	1951-1959	9
α-helix	1962-1964	3
α-helix	1965-1968	4
β-strand	1969	1	4
α-helix	1973-1978	6
α-helix	1983-1992	10
β-strand	2000-2003	4	5
α-helix	2011-2020	10
β-strand	2024-2026	3	5
β-strand	2037-2040	4	5
α-helix	2046-2048	3
α-helix	2050-2055	6
α-helix	2057-2058	2
β-strand	2059-2060	2	5
α-helix	2063-2071	9
α-helix	2076-2078	3
β-strand	2080	1	5

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	139-140	2
β-strand	141	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of DNA damage checkpoint protein 1	A, B	protein	207	Homo sapiens	Q14676 (AlphaFold model)
Gamma-H2AX histone	C, D	protein	10		P16104 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2AZM_1 Mediator of DNA damage checkpoint protein 1 (chains A, B)
RTKLNQESTAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALG
RGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIY
VTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSP
EFLLTGVLKQEAKPEAFVLSPLEMSST

Sequence of entity 2 (C, D), FASTA

>2AZM_2 GAMMA-H2AX HISTONE (chains C, D)
KKATQASQEY

Primary citation

MDC1 Directly Binds Phosphorylated Histone H2AX to Regulate Cellular Responses to DNA Double-Strand Breaks. Stucki, M., Clapperton, J.A., Mohammad, D. et al. Cell (2005) 123:1213-1226. DOI 10.1016/j.cell.2005.09.038 · PubMed

Other PDB entries of the same protein (UniProt Q14676 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ETX 1.33 Å, Crystal Structure of MDC1 Tandem BRCT Domains
3K05 1.33 Å, The crystal structure of MDC1 BRCT T2067D in complex with a minimal recognition…
2ADO 1.45 Å, Crystal Structure Of The Brct Repeat Region From The Mediator of DNA damage checkpoint…
3UMZ 1.65 Å, Crystal Structure of the human MDC1 FHA Domain
3UNN 1.7 Å, Monomeric structure of the human MDC1 FHA domain in complex with an MDC1 phospho-T4…
3UNM 1.8 Å, Crystal Structure of The Human MDC1 FHA Domain
3UOT 1.8 Å, Crystal Structure of MDC1 FHA Domain in Complex with a Phosphorylated Peptide from the…
3UN0 2.3 Å, Crystal Structure of MDC1 FHA Domain
9QJZ 2.31 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide…
9IF9 2.55 Å, Crystal structure of the Pellino 1 FHA domain in complex with a MDC1-TQxF phosphopeptide.
3UEO 2.6 Å, Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide

Browse structure collections

About this viewer

MolViewer shows 2AZM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.