3UN0: MDC1 FHA Domain

Crystal Structure of MDC1 FHA Domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Dec 2011.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,813
Mol. weight: 26.01 kDa
Released: 28 Dec 2011

Explore 3UN0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UN0 contains 6 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	28-29	2
β-strand	30-36	7	3
β-strand	45-50	6	3
β-strand	52-57	6	4
β-strand	64-65	2	4
β-strand	76-80	5	4
β-strand	88-91	4	4
β-strand	98-101	4	3
β-strand	104-106	3	3
α-helix	107-108	2
β-strand	113-114	2	4
α-helix	115-116	2
β-strand	120-123	4	3
β-strand	126-132	7	3

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	28-30	3
β-strand	32-36	5	1
α-helix	37	1
β-strand	45-49	5	1
β-strand	52-57	6	2
β-strand	64-65	2	2
β-strand	76-80	5	2
β-strand	88-91	4	2
β-strand	98-101	4	1
β-strand	104-106	3	1
β-strand	113-114	2	2
α-helix	115-116	2
β-strand	120-123	4	1
β-strand	126-132	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of DNA damage checkpoint protein 1	A, B	protein	115	Homo sapiens	Q14676 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3UN0_1 Mediator of DNA damage checkpoint protein 1 (chains A, B)
GSCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAW
DKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRLDVSLP

Primary citation

The molecular basis of ATM-dependent dimerization of the Mdc1 DNA damage checkpoint mediator. Jungmichel, S., Clapperton, J.A., Lloyd, J. et al. Nucleic Acids Res (2012) 40:3913-3928. DOI 10.1093/nar/gkr1300 · PubMed

Other PDB entries of the same protein (UniProt Q14676 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ETX 1.33 Å, Crystal Structure of MDC1 Tandem BRCT Domains
3K05 1.33 Å, The crystal structure of MDC1 BRCT T2067D in complex with a minimal recognition…
2ADO 1.45 Å, Crystal Structure Of The Brct Repeat Region From The Mediator of DNA damage checkpoint…
3UMZ 1.65 Å, Crystal Structure of the human MDC1 FHA Domain
3UNN 1.7 Å, Monomeric structure of the human MDC1 FHA domain in complex with an MDC1 phospho-T4…
3UNM 1.8 Å, Crystal Structure of The Human MDC1 FHA Domain
3UOT 1.8 Å, Crystal Structure of MDC1 FHA Domain in Complex with a Phosphorylated Peptide from the…
9QJZ 2.31 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide…
2AZM 2.41 Å, Crystal structure of the MDC1 brct repeat in complex with the histone tail of gamma-H2AX
9IF9 2.55 Å, Crystal structure of the Pellino 1 FHA domain in complex with a MDC1-TQxF phosphopeptide.
3UEO 2.6 Å, Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide

Browse structure collections

About this viewer

MolViewer shows 3UN0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.