3UEO: TopBP1 BRCT4/5 domains

Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide. Determined by X-ray diffraction at 2.6 Å resolution. Released 3 Jul 2013.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 6
Atoms: 6,132
Mol. weight: 91.98 kDa
Released: 3 Jul 2013

Explore 3UEO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UEO contains 39 α-helices and 48 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	557-560	4	1
α-helix	565-576	12
β-strand	581-582	2	1
β-strand	591-596	6	1
β-strand	607-612	6	1
α-helix	613-621	9
α-helix	628-630	3
α-helix	632-634	3
β-strand	650-653	4	2
α-helix	658-670	13
β-strand	674-675	2	2
β-strand	684	1	3
β-strand	689	1	3
β-strand	694-696	3	2
α-helix	703-711	9
β-strand	715-716	2	2
α-helix	718-727	10
α-helix	733-735	3
β-strand	737	1	2
α-helix	738-740	3

Chain B: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	557-560	4	4
α-helix	565-576	12
β-strand	581-582	2	4
β-strand	591-596	6	4
β-strand	607-612	6	4
α-helix	613-621	9
α-helix	628-630	3
α-helix	632-634	3
α-helix	636-638	3
β-strand	650-653	4	5
α-helix	658-670	13
β-strand	674-675	2	5
β-strand	684	1	6
β-strand	689	1	6
β-strand	694-696	3	5
α-helix	703-711	9
β-strand	715-716	2	5
α-helix	718-727	10
α-helix	733-735	3
β-strand	737	1	5
α-helix	738-740	3

Chains C and D: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	557-560	4	7
α-helix	565-576	12
β-strand	581-582	2	7
β-strand	591-596	6	7
β-strand	607-612	6	7
α-helix	613-622	10
α-helix	628-630	3
α-helix	636-638	3
β-strand	650-653	4	8
α-helix	658-670	13
β-strand	674-675	2	8
β-strand	679-680	2	9
β-strand	684	1	10
β-strand	689	1	10
α-helix	690-692	3
β-strand	694-697	4	8
α-helix	702-711	10
β-strand	715-717	3	8
α-helix	718-727	10
α-helix	733-735	3
β-strand	737	1	8
α-helix	738-740	3

Chains E and F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	8-9	2	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA topoisomerase 2-binding protein 1	A, B, C, D	protein	203	Homo sapiens	Q92547 (AlphaFold model)
phospho-peptide	E, F	protein	12		Q14676 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3UEO_1 DNA topoisomerase 2-binding protein 1 (chains A, B, C, D)
GPLGSEEGLFSQKSFLVLGFSNENESNIANIIKENAGKIMSLLSRTVADYAVVPLLGCEV
EATVGEVVTNTWLVTCIDYQTLFDPKSNPLFTPVPVMTGMTPLEDCVISFSQCAGAEKES
LTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERGGSKYEAAKKWNLPAVTIAWLLE
TARTGKRADESHFLIENSTKEER

Sequence of entity 2 (E, F), FASTA

>3UEO_2 phospho-peptide (chains E, F)
GFIDSDTDVEEE

Primary citation

Structural insights into recognition of MDC1 by TopBP1 in DNA replication checkpoint control. Leung, C.C., Sun, L., Gong, Z. et al. Structure (2013) 21:1450-1459. DOI 10.1016/j.str.2013.06.015 · PubMed

Other PDB entries of the same protein (UniProt Q92547 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PD7 1.26 Å, Crystal Structure of the Sixth BRCT Domain of Human TopBP1
3JVE 1.34 Å, Crystal Structure of the Sixth BRCT Domain of TopBP1
9MAT 1.65 Å, TopBP1 BRCT 7-8 Domain
7CMZ 1.7 Å, Crystal Structure of BRCT7/8 in Complex with the APS Motif of PHF8
3UEN 1.9 Å, Crystal structure of TopBP1 BRCT4/5 domains
3AL2 2.0 Å, Crystal Structure of TopBP1 BRCT7/8
3AL3 2.15 Å, Crystal Structure of TopBP1 BRCT7/8-BACH1 peptide complex
3OLC 2.4 Å, Crystal structure of the N-terminal region of TopBP1
9MAW 2.45 Å, Crystal structure of TOPBP1BRCT7-8 domain in complex with 1-Adamantaneacetic acid
2XNK 2.6 Å, Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor…
2XNH 2.8 Å, Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor…
6RML 2.81 Å, Crystal structure of TOPBP1 BRCT0,1,2 in complex with a 53BP1 phosphopeptide

Browse structure collections

About this viewer

MolViewer shows 3UEO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.