2B02: ARNT PAS-B Domain

Crystal Structure of ARNT PAS-B Domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 24 Oct 2006.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,112
Mol. weight: 14.12 kDa
Released: 24 Oct 2006

Explore 2B02 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2B02 contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	362-367	6	1
β-strand	372	1	2
β-strand	373-376	4	1
α-helix	380-384	5
α-helix	388-390	3
β-strand	395	1	2
α-helix	396-399	4
β-strand	400	1	1
α-helix	402-404	3
α-helix	405-417	13
β-strand	423-430	8	1
β-strand	436-447	12	1
α-helix	448	1
β-strand	454-463	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aryl hydrocarbon receptor nuclear translocator	A	protein	119	Homo sapiens	P27540 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2B02_1 Aryl hydrocarbon receptor nuclear translocator (chains A)
GHMSNVSQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDS
FQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQE

Primary citation

Crystal Structure and Binding Properties of ARNT PAS-B Heterodimerization Domain. Lee, J., Botuyan, M.V., Nomine, Y. et al. To be published.

Other PDB entries of the same protein (UniProt P27540 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3F1P 1.17 Å, Crystal structure of a high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
3F1N 1.48 Å, Crystal structure of a high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
3H82 1.5 Å, Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
4GHI 1.5 Å, Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
6D0C 1.5 Å, Crystal structure of HIF2a-B*:ARNT-B* complex
4H6J 1.52 Å, Identification of Cys 255 in HIF-1 as a novel site for development of covalent…
6X21 1.54 Å, Crystal structure of PT1673 bound to HIF2a-B*:ARNT-B* complex
9I64 1.56 Å, Crystal structure of Casdatifan bound to HIF2a-B*:ARNT-B* complex
3F1O 1.6 Å, Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
4EQ1 1.6 Å, Crystal Structure of the ARNT PAS-B homodimer
6CZW 1.6 Å, Crystal structure of PT1940 bound to HIF2a-B*:ARNT-B* complex
6D0B 1.6 Å, Crystal structure of PT1614 bound to HIF2a-B*:ARNT-B* complex

Browse structure collections

About this viewer

MolViewer shows 2B02 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.