4EQ1: ARNT PAS-B homodimer

Crystal Structure of the ARNT PAS-B homodimer. Determined by X-ray diffraction at 1.6 Å resolution. Released 17 Apr 2013.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,044
Mol. weight: 26.1 kDa
Ligands: PE5
Released: 17 Apr 2013

Explore 4EQ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EQ1 contains 13 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	357-358	2	1
α-helix	359-360	2
β-strand	362-367	6	2
β-strand	372	1	3
β-strand	373-376	4	2
α-helix	379-384	6
α-helix	388-391	4
β-strand	395	1	3
α-helix	396-399	4
β-strand	400	1	2
α-helix	402-404	3
α-helix	405-417	13
β-strand	422-430	9	2
β-strand	436-447	12	2
α-helix	448	1
β-strand	454-463	10	2

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	357-358	2	2
β-strand	362-367	6	1
β-strand	372	1	4
β-strand	373-376	4	1
α-helix	379-384	6
α-helix	388-391	4
β-strand	395	1	4
α-helix	396-399	4
β-strand	400	1	1
α-helix	402-404	3
α-helix	405-417	13
β-strand	422-430	9	1
β-strand	436-447	12	1
α-helix	448	1
β-strand	454-463	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aryl hydrocarbon receptor nuclear translocator	A, B	protein	109	Homo sapiens	P27540 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4EQ1_1 Aryl hydrocarbon receptor nuclear translocator (chains A, B)
GVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQV
VKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV

Ligands and cofactors

ID	Name	Formula	Copies
PE5	3,6,9,12,15,18,21,24-octaoxahexacosan-1-ol	C18 H38 O9	1

Primary citation

Regulating the ARNT/TACC3 Axis: Multiple Approaches to Manipulating Protein/Protein Interactions with Small Molecules. Guo, Y., Partch, C.L., Key, J. et al. ACS Chem Biol (2013) 8:626-635. DOI 10.1021/cb300604u · PubMed

Other PDB entries of the same protein (UniProt P27540 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3F1P 1.17 Å, Crystal structure of a high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
3F1N 1.48 Å, Crystal structure of a high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
2B02 1.5 Å, Crystal Structure of ARNT PAS-B Domain
3H82 1.5 Å, Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
4GHI 1.5 Å, Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
6D0C 1.5 Å, Crystal structure of HIF2a-B*:ARNT-B* complex
4H6J 1.52 Å, Identification of Cys 255 in HIF-1 as a novel site for development of covalent…
6X21 1.54 Å, Crystal structure of PT1673 bound to HIF2a-B*:ARNT-B* complex
9I64 1.56 Å, Crystal structure of Casdatifan bound to HIF2a-B*:ARNT-B* complex
3F1O 1.6 Å, Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
6CZW 1.6 Å, Crystal structure of PT1940 bound to HIF2a-B*:ARNT-B* complex
6D0B 1.6 Å, Crystal structure of PT1614 bound to HIF2a-B*:ARNT-B* complex

Browse structure collections

About this viewer

MolViewer shows 4EQ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.