3H82: Aryl hydrocarbon receptor nuclear translocator

Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS domains with the artificial ligand THS020. Determined by X-ray diffraction at 1.5 Å resolution. Released 12 Jan 2010.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,228
Mol. weight: 28.07 kDa
Ligands: 020
Released: 12 Jan 2010

Explore 3H82 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3H82 contains 12 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	240-242	3
β-strand	243-248	6	3
β-strand	253	1	4
β-strand	254-257	4	3
α-helix	260-265	6
α-helix	269-272	4
β-strand	276	1	4
α-helix	277-280	4
β-strand	281	1	3
α-helix	286-299	14
β-strand	301-303	3	3
β-strand	307-310	4	3
β-strand	316-328	13	3
β-strand	333-343	11	3
β-strand	348	1	3

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	358-361	4
β-strand	362-367	6	1
β-strand	372	1	2
β-strand	373-376	4	1
α-helix	380-384	5
α-helix	388-391	4
β-strand	395	1	2
α-helix	396-399	4
β-strand	400	1	1
α-helix	402-404	3
α-helix	405-417	13
β-strand	423-430	8	1
β-strand	436-446	11	1
α-helix	453-455	3
β-strand	456-463	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aryl hydrocarbon receptor nuclear translocator	B	protein	121	Homo sapiens	P27540 (AlphaFold model)
Endothelial PAS domain-containing protein 1	A	protein	117	Homo sapiens	Q99814 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>3H82_1 Aryl hydrocarbon receptor nuclear translocator (chains B)
GEFKGLNVCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLR
DSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQ
E

Sequence of entity 2 (A), FASTA

>3H82_2 Endothelial PAS domain-containing protein 1 (chains A)
GEFKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSH
QNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKN

Ligands and cofactors

ID	Name	Formula	Copies
020	N-(furan-2-ylmethyl)-2-nitro-4-(trifluoromethyl)aniline	C12 H9 F3 N2 O3	1

Primary citation

Principles of ligand binding within a completely buried cavity in HIF2alpha PAS-B. Key, J., Scheuermann, T.H., Anderson, P.C. et al. J Am Chem Soc (2009) 131:17647-17654. DOI 10.1021/ja9073062 · PubMed

Other PDB entries of the same protein (UniProt P27540 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3F1P 1.17 Å, Crystal structure of a high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
3F1N 1.48 Å, Crystal structure of a high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
2B02 1.5 Å, Crystal Structure of ARNT PAS-B Domain
4GHI 1.5 Å, Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
6D0C 1.5 Å, Crystal structure of HIF2a-B*:ARNT-B* complex
4H6J 1.52 Å, Identification of Cys 255 in HIF-1 as a novel site for development of covalent…
6X21 1.54 Å, Crystal structure of PT1673 bound to HIF2a-B*:ARNT-B* complex
9I64 1.56 Å, Crystal structure of Casdatifan bound to HIF2a-B*:ARNT-B* complex
3F1O 1.6 Å, Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS…
4EQ1 1.6 Å, Crystal Structure of the ARNT PAS-B homodimer
6CZW 1.6 Å, Crystal structure of PT1940 bound to HIF2a-B*:ARNT-B* complex
6D0B 1.6 Å, Crystal structure of PT1614 bound to HIF2a-B*:ARNT-B* complex

Browse structure collections

About this viewer

MolViewer shows 3H82 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.