2B05: 14-3-3 gamma

Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide. Determined by X-ray diffraction at 2.55 Å resolution. Released 11 Oct 2005.

Method

X-ray diffraction

Resolution

2.55 Å

Organism

Homo sapiens

Chains

12

Atoms

11,088

Mol. weight

173.65 kDa

Released

11 Oct 2005

Explore 2B05 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2B05 contains 76 α-helices and 0 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and F: 12 helices, 0 β-strands

Molecules and chains

>2B05_1 14-3-3 protein gamma (chains A, B, C, D, E, F)
VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWR
VISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKV
FYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSV
FYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDD
GGEGNN

>2B05_2 peptide (chains G, H, I, J, K, L)
RAISLP

Primary citation

Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide. Papagrigoriou, E., Elkins, J., Arrowsmith, C. et al. To be published.

Related structures

Other PDB entries of the same protein (UniProt P61981 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 6S9K 1.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 peptide containing 14-3-3 binding…
• 6ZBT 1.8 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342
• 3UZD 1.86 Å, Crystal structure of 14-3-3 GAMMA
• 6ZC9 1.9 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448
• 6A5S 2.1 Å, Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif
• 4E2E 2.25 Å, Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation…
• 7A6Y 2.5 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide stabilized by FC-A
• 6GKF 2.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139
• 6BZD 2.67 Å, Structure of 14-3-3 gamma R57E mutant bound to GlcNAcylated peptide
• 7A6R 2.7 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide containing the 14-3-3 binding…
• 5D3E 2.75 Å, Crystal structure of human 14-3-3 gamma in complex with CFTR R-domain peptide pS768-pS795
• 6SAD 2.75 Å, Structure of 14-3-3 gamma in complex with double phosphorylated caspase-2 peptide on…

Browse structure collections

About this viewer

MolViewer shows 2B05 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.