2BBU: Mouse socs3

solution structure of mouse socs3 in complex with a phosphopeptide from the gp130 receptor. Determined by solution NMR. Released 2 May 2006.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 1,316
Mol. weight: 19.57 kDa
Released: 2 May 2006

Explore 2BBU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BBU contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	2-14	13
α-helix	24-33	10
β-strand	40-43	4	1
β-strand	51-55	5	1
β-strand	62-65	4	1
β-strand	67-69	3	2
β-strand	72-74	3	2
α-helix	90-98	9
β-strand	138-139	2	3
β-strand	144-145	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Suppressor of cytokine signaling 3	A	protein	164	Mus musculus	O35718 (AlphaFold model)
GP130 phosphopeptide	B	protein	15		Q00560 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BBU_1 Suppressor of cytokine signaling 3 (chains A)
LKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFT
LSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPT
EPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSN

Sequence of entity 2 (B), FASTA

>2BBU_2 GP130 PHOSPHOPEPTIDE (chains B)
STASTVEYSTVVHSG

Primary citation

The Structure of SOCS3 Reveals the Basis of the Extended SH2 Domain Function and Identifies an Unstructured Insertion That Regulates Stability. Babon, J.J., McManus, E.J., Yao, S. et al. Mol Cell (2006) 22:205-216. DOI 10.1016/j.molcel.2006.03.024 · PubMed

Other PDB entries of the same protein (UniProt O35718 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HMH 2.0 Å, Crystal structure of SOCS3 in complex with gp130(pTyr757) phosphopeptide.
4GL9 3.9 Å, Crystal structure of inhibitory protein SOCS3 in complex with JAK2 kinase domain and…
2JZ3 SOCS box elonginBC ternary complex

Browse structure collections

About this viewer

MolViewer shows 2BBU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.