2BCQ: DNA polymerase lambda

DNA polymerase lambda in complex with a DNA duplex containing an unpaired Dtmp. Determined by X-ray diffraction at 1.65 Å resolution. Released 7 Mar 2006.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,624
Mol. weight: 44.78 kDa
Ligands: PPV, MG
Released: 7 Mar 2006

Explore 2BCQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BCQ contains 19 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	254-269	16
α-helix	273-287	15
α-helix	296-300	5
α-helix	307-318	12
α-helix	323-327	5
α-helix	332-339	8
α-helix	346-354	9
α-helix	360-366	7
α-helix	371-378	8
α-helix	382-384	3
β-strand	387-388	2	1
α-helix	389-404	16
β-strand	411-414	4	2
α-helix	416-419	4
β-strand	424-425	2	1
β-strand	428-433	6	2
α-helix	444-453	10
β-strand	457-462	6	2
β-strand	472-477	6	2
β-strand	487-493	7	2
α-helix	496-498	3
α-helix	499-507	9
α-helix	510-522	13
β-strand	526-527	2	3
β-strand	532-534	3	3
β-strand	537-538	2	4
β-strand	544-546	3	4
β-strand	549-550	2	3
α-helix	551-552	2
α-helix	556-562	7
α-helix	570-573	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(pgpcpcpg)-3'	D	DNA	4
5'-d(cpapgptpapcp*g)-3'	P	DNA	7
5'-d(cpgpgpcpcpgptptpapcptpg)-3'	T	DNA	12
DNA polymerase lambda	A	protein	335	Homo sapiens	Q9UGP5 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>2BCQ_1 5'-D(P*GP*CP*CP*G)-3' (chains D)
GCCG

Sequence of entity 2 (P), FASTA

>2BCQ_2 5'-D(*CP*AP*GP*TP*AP*CP*G)-3' (chains P)
CAGTACG

Sequence of entity 3 (T), FASTA

>2BCQ_3 5'-D(*CP*GP*GP*CP*CP*GP*TP*TP*AP*CP*TP*G)-3' (chains T)
CGGCCGTTACTG

Sequence of entity 4 (A), FASTA

>2BCQ_4 DNA polymerase lambda (chains A)
MAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEAC
SIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSL
EDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR
GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLP
GPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNT
HGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Ligands and cofactors

ID	Name	Formula	Copies
PPV	Pyrophosphate	H4 O7 P2	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (EDO, NA) are not listed.

Primary citation

Structural analysis of strand misalignment during DNA synthesis by a human DNA polymerase. Garcia-Diaz, M., Bebenek, K., Krahn, J.M. et al. Cell (2006) 124:331-342. DOI 10.1016/j.cell.2005.10.039 · PubMed

Other PDB entries of the same protein (UniProt Q9UGP5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M07 1.57 Å, Pre-catalytic ternary complex of DNA Polymerase Lambda with bound 1-nt gapped SSB…
7M49 1.6 Å, DNA Polymerase Lambda, TTP:At Mn2+ Reaction State Ternary Complex, 5 min
9NPU 1.63 Å, Pre-catalytic ternary complex of DNA Polymerase Lambda with bound 1-nt gapped SSB…
7M47 1.65 Å, DNA Polymerase Lambda, TTP:At Mg2+ Product State Ternary Complex, 60 min
7M09 1.65 Å, Pre-catalytic quaternary complex of DNA Polymerase Lambda with blunt-ended DSB substrate…
7M4B 1.66 Å, DNA Polymerase Lambda, TTP:At Mn2+ Product State Ternary Complex, 60 min
7M08 1.7 Å, Post-catalytic nicked complex of DNA Polymerase Lambda with bound 1-nt gapped SSB…
7M4L 1.7 Å, DNA Polymerase Lambda, TTPaS:At Mn2+ Product State Ternary Complex, 60 min
7M4K 1.72 Å, DNA Polymerase Lambda, TTPaS:At Ca2+ Ground State Ternary Complex
5IIJ 1.72 Å, Crystal structure of the pre-catalytic ternary complex of DNA polymerase lambda with a…
2BCR 1.75 Å, DNA polymerase lambda in complex with a DNA duplex containing an unpaired Damp
5III 1.8 Å, Crystal structure of the pre-catalytic ternary complex of DNA polymerase lambda with a…

Browse structure collections

About this viewer

MolViewer shows 2BCQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.