2BDN: Human MCP-1

Crystal structure of human MCP-1 bound to a blocking antibody, 11K2. Determined by X-ray diffraction at 2.53 Å resolution. Released 13 Jun 2006.

Method: X-ray diffraction
Resolution: 2.53 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,869
Mol. weight: 55.4 kDa
Released: 13 Jun 2006

Explore 2BDN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BDN contains 17 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	22-24	3
β-strand	25-31	7	1
β-strand	40-45	6	1
β-strand	50-53	4	1
α-helix	58-69	12

Chain H: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	7
β-strand	9-12	4	8
β-strand	18-23	6	9
β-strand	24-25	2	7
α-helix	29-31	3
β-strand	34-40	7	8
β-strand	44-52	9	8
β-strand	57-60	4	8
α-helix	62-64	3
β-strand	68-73	6	9
β-strand	78-83	6	9
α-helix	88-90	3
β-strand	92-98	7	8
β-strand	106-107	2	8
β-strand	108	1	7
β-strand	111-115	5	8
β-strand	121	1	10
β-strand	124-128	5	11
β-strand	139-149	11	11
β-strand	150	1	10
β-strand	156-158	3	12
α-helix	159-161	3
β-strand	167-169	3	11
α-helix	170-172	3
β-strand	173-174	2	11
β-strand	179-188	10	11
α-helix	189-191	3
β-strand	198-203	6	12
α-helix	204-206	3
β-strand	208-213	6	12

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	2
β-strand	10-13	4	3
β-strand	19-25	7	2
β-strand	33-38	6	3
β-strand	45-49	5	3
β-strand	53-54	2	3
α-helix	55	1
β-strand	62-67	6	2
β-strand	70-75	6	2
α-helix	80-82	3
β-strand	85-90	6	3
α-helix	96	1
β-strand	97-98	2	3
β-strand	102-106	5	3
β-strand	111	1	4
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-155	3	6
β-strand	159-163	5	5
α-helix	165-167	3
β-strand	173-182	10	5
α-helix	183-188	6
β-strand	191-197	7	6
α-helix	204	1
β-strand	205-210	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small inducible cytokine A2	A	protein	76		P13500 (AlphaFold model)
Antibody light chain 11K2	L	protein	214	Mus musculus
Antibody heavy chain 11K2	H	protein	217	Mus musculus

Sequence of entity 1 (A), FASTA

>2BDN_1 Small inducible cytokine A2 (chains A)
QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWV
QDSMDHLDKQTQTPKT

Sequence of entity 2 (L), FASTA

>2BDN_2 Antibody light chain 11K2 (chains L)
DIQMTQSSSSFSVSLGDRVTITCKATEDIYNRLAWYQQKPGSAPRLLISGATSLETGVPS
RFSGSGSGKDYTLSITSLQTEDVATYYCQQFWSAPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (H), FASTA

>2BDN_3 Antibody heavy chain 11K2 (chains H)
EVQLQQSGAELVKAGASVKLSCPASGLNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKF
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCARGVFGFFDYWGQGTTLTVSSAKT
TAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYT
LSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPR

Primary citation

Structure activity relationships of monocyte chemoattractant proteins in complex with a blocking antibody. Reid, C., Rushe, M., Jarpe, M. et al. Protein Eng Des Sel (2006) 19:317-324. DOI 10.1093/protein/gzl015 · PubMed

Other PDB entries of the same protein (UniProt P13500 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SO0 1.74 Å, Crystal Structure of the Engineered Tick Evasin EVA-P974(F31A) Complexed to Human…
1DOK 1.85 Å, Monocyte chemoattractant protein 1, P-form
3IFD 1.9 Å, Human synthetic monocyte chemoattractant protein 1 (MCP-1)
4R8I 2.05 Å, High Resolution Structure of a Mirror-Image RNA Oligonucleotide Aptamer in Complex with…
1DOL 2.4 Å, Monocyte chemoattractant protein 1, I-form
2NZ1 2.5 Å, Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The…
4ZK9 2.6 Å, The chemokine binding protein of orf virus complexed with CCL2
1ML0 2.8 Å, Viral chemokine binding protein M3 from murine GAMMAHERPESVIRUS68 in complex with the…
4DN4 2.8 Å, Crystal structure of the complex between cnto888 fab and mcp-1 mutant p8a
7XA3 2.9 Å, Cryo-EM structure of the CCL2 bound CCR2-Gi complex
8FJ0 2.91 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL2
1DOM Solution structure of the monocyte chemoattractant protein-1 dimer using heteronuclear,…

Browse structure collections

About this viewer

MolViewer shows 2BDN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.