2BIV: Wild-type MBT domains of Human SCML2

Crystal structure of the wild-type MBT domains of Human SCML2. Determined by X-ray diffraction at 1.7 Å resolution. Released 8 Feb 2005.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 5,481
Mol. weight: 82.92 kDa
Released: 8 Feb 2005

Explore 2BIV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BIV contains 36 α-helices and 39 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	35-42	8
β-strand	46	1	1
α-helix	47-48	2
α-helix	49-51	3
α-helix	58-60	3
β-strand	68-73	6	2
β-strand	76-89	14	2
β-strand	92-97	6	2
β-strand	106-109	4	2
β-strand	115-116	2	2
α-helix	120-123	4
α-helix	138-140	3
α-helix	141-149	9
β-strand	154	1	2
α-helix	155-156	2
α-helix	157-159	3
α-helix	161-167	7
β-strand	177-181	5	1
β-strand	189-198	10	1
β-strand	201-206	6	1
α-helix	211-213	3
β-strand	215-218	4	1
β-strand	224-225	2	1
α-helix	229-233	5
β-strand	237	1	1
α-helix	238-241	4

Chain B: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	35-41	7
β-strand	46	1	3
α-helix	47-48	2
α-helix	49-51	3
α-helix	58-60	3
β-strand	68-73	6	4
β-strand	76-89	14	4
β-strand	92-97	6	4
β-strand	106-109	4	4
β-strand	115-116	2	4
α-helix	120-123	4
α-helix	141-149	9
α-helix	153	1
β-strand	154	1	4
α-helix	155-156	2
α-helix	157-159	3
α-helix	162-167	6
β-strand	177-181	5	3
β-strand	189-198	10	3
β-strand	201-206	6	3
β-strand	215-218	4	3
β-strand	224-225	2	3
α-helix	229-233	5
β-strand	237	1	3
α-helix	238-241	4

Chain C: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	35-41	7
β-strand	46	1	5
α-helix	47-48	2
α-helix	49-51	3
α-helix	58-60	3
β-strand	68-73	6	6
β-strand	76-89	14	6
β-strand	92-97	6	6
β-strand	106-109	4	6
β-strand	115-116	2	6
α-helix	120-123	4
β-strand	154	1	6
α-helix	155-156	2
α-helix	157-159	3
α-helix	161-167	7
β-strand	177-181	5	5
β-strand	189-198	10	5
β-strand	201-206	6	5
α-helix	211-213	3
β-strand	215-218	4	5
β-strand	224-225	2	5
α-helix	229-233	5
β-strand	237	1	5
α-helix	238-240	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sex comb on midleg-like protein 2	A, B, C	protein	243	HOMO SAPIENS	Q9UQR0 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2BIV_1 SEX COMB ON MIDLEG-LIKE PROTEIN 2 (chains A, B, C)
MGQTVNEDSMDVKKENQEKTPQSSTSSVQRDDFHWEEYLKETGSISAPSECFRQSQIPPV
NDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGT
CEKEGDLLQPPLGYQMNTSSWPMFLLKTLNGSEMASATLFKKEPPKPPLNNFKVGMKLEA
IDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPP
GTS

Primary citation

The Malignant Brain Tumor Repeats of Human Scml2 Bind to Peptides Containing Monomethylated Lysine. Santiveri, C.M., Lechtenberg, B.C., Allen, M.D. et al. J Mol Biol (2008) 382:1107. DOI 10.1016/J.JMB.2008.07.081 · PubMed

Other PDB entries of the same protein (UniProt Q9UQR0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OI1 1.78 Å, Crystal Structure of the MBT domains of Human SCML2
2VYT 1.9 Å, The MBT repeats of human SCML2 bind to peptides containing mono methylated lysine.
4EDU 2.58 Å, The MBT repeats of human SCML2 in a complex with histone H2A peptide
2MEM Solution NMR structure of SLED domain of Scml2

Browse structure collections

About this viewer

MolViewer shows 2BIV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.