The MBT repeats of human SCML2 in a complex with histone H2A peptide. Determined by X-ray diffraction at 2.58 Å resolution. Released 19 Sept 2012.
Explore 4EDU in 3D Show helices and sheets RCSB PDB PDBe
4EDU contains 14 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 35-42 | 8 | |
| β-strand | 46 | 1 | 1 |
| α-helix | 47-48 | 2 | |
| α-helix | 49-51 | 3 | |
| α-helix | 58-60 | 3 | |
| β-strand | 68-73 | 6 | 2 |
| β-strand | 76-89 | 14 | 2 |
| β-strand | 92-97 | 6 | 2 |
| β-strand | 106-109 | 4 | 2 |
| β-strand | 115-117 | 3 | 2 |
| α-helix | 120-124 | 5 | |
| α-helix | 126-128 | 3 | |
| α-helix | 138-140 | 3 | |
| α-helix | 141-149 | 9 | |
| β-strand | 154 | 1 | 2 |
| α-helix | 155-156 | 2 | |
| α-helix | 157-159 | 3 | |
| α-helix | 161-167 | 7 | |
| β-strand | 177-181 | 5 | 1 |
| β-strand | 189-198 | 10 | 1 |
| β-strand | 201-206 | 6 | 1 |
| α-helix | 211-213 | 3 | |
| β-strand | 215-218 | 4 | 1 |
| β-strand | 224-225 | 2 | 1 |
| α-helix | 229-233 | 5 | |
| β-strand | 237 | 1 | 1 |
| α-helix | 238-240 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sex comb on midleg-like protein 2 | A | protein | 215 | Homo sapiens | Q9UQR0 (AlphaFold model) |
| Histone H2A.J peptide | T | protein | 16 | Homo sapiens | Q9BTM1 (AlphaFold model) |
>4EDU_1 Sex comb on midleg-like protein 2 (chains A) QRDDFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGI TGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLET LNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDG WSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
>4EDU_2 Histone H2A.J peptide (chains T) VHRLLRKGNYAERVGA
Histone recognition by human malignant brain tumor domains. Nady, N., Krichevsky, L., Zhong, N. et al. J Mol Biol (2012) 423:702-718. DOI 10.1016/j.jmb.2012.08.022 · PubMed
Other PDB entries of the same protein (UniProt Q9UQR0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4EDU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.