EGF Domains 1,2,5 of human EMR2, a 7-TM immune system molecule, in complex with calcium. Determined by X-ray diffraction at 2.6 Å resolution. Released 9 Aug 2006.
Explore 2BO2 in 3D Show helices and sheets RCSB PDB PDBe
2BO2 contains 12 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-10 | 2 | |
| β-strand | 13-15 | 3 | 1 |
| β-strand | 21-23 | 3 | 1 |
| α-helix | 24 | 1 | |
| β-strand | 27-28 | 2 | 2 |
| β-strand | 34 | 1 | 1 |
| β-strand | 42-43 | 2 | 2 |
| α-helix | 44 | 1 | |
| β-strand | 59-64 | 6 | 3 |
| β-strand | 67-72 | 6 | 3 |
| α-helix | 73 | 1 | |
| β-strand | 76-78 | 3 | 4 |
| β-strand | 85 | 1 | 3 |
| α-helix | 88-90 | 3 | |
| β-strand | 93-95 | 3 | 4 |
| β-strand | 110-114 | 5 | 5 |
| β-strand | 119-123 | 5 | 5 |
| α-helix | 124 | 1 | |
| β-strand | 129 | 1 | 6 |
| β-strand | 137 | 1 | 5 |
| β-strand | 142 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-15 | 3 | 7 |
| β-strand | 21-23 | 3 | 7 |
| α-helix | 24 | 1 | |
| β-strand | 27-28 | 2 | 8 |
| β-strand | 34 | 1 | 7 |
| β-strand | 42-43 | 2 | 8 |
| α-helix | 44 | 1 | |
| β-strand | 59-64 | 6 | 9 |
| β-strand | 67-72 | 6 | 9 |
| α-helix | 73 | 1 | |
| β-strand | 76-78 | 3 | 10 |
| β-strand | 85 | 1 | 9 |
| α-helix | 88-90 | 3 | |
| β-strand | 93-95 | 3 | 10 |
| β-strand | 110-114 | 5 | 11 |
| β-strand | 119-123 | 5 | 11 |
| α-helix | 124 | 1 | |
| β-strand | 129 | 1 | 12 |
| α-helix | 130 | 1 | |
| β-strand | 137 | 1 | 11 |
| β-strand | 142 | 1 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Egf-like module containing mucin-like hormone receptor-like 2 precursor | A, B | protein | 143 | HOMO SAPIENS | Q9UHX3 (AlphaFold model) |
>2BO2_1 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE RECEPTOR-LIKE 2 PRECURSOR (chains A, B) DSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSD CWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECSSGQHQCDSSTVCFNTVGSYS CRCRPGWKPRHGIPNNQKDTVCE
Structural and Functional Characterization of a Novel T Cell Receptor Co-Regulatory Protein Complex, Cd97-Cd55. Abbott, R.J.M., Spendlove, I., Roversi, P. et al. J Biol Chem (2007) 282:22023. DOI 10.1074/JBC.M702588200 · PubMed
Other PDB entries of the same protein (UniProt Q9UHX3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2BO2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.