How family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides. Structure and activity of a clostridium thermocellum lichenase, CtLIC26A. Determined by X-ray diffraction at 1.5 Å resolution. Released 30 Jun 2005.
Explore 2BV9 in 3D Show helices and sheets RCSB PDB PDBe
2BV9 contains 9 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-14 | 5 | 1 |
| α-helix | 21-31 | 11 | |
| β-strand | 37-43 | 7 | 1 |
| α-helix | 48-60 | 13 | |
| β-strand | 64-70 | 7 | 1 |
| α-helix | 76-80 | 5 | |
| α-helix | 85-98 | 14 | |
| β-strand | 102-106 | 5 | 1 |
| α-helix | 128-144 | 17 | |
| β-strand | 150-152 | 3 | 1 |
| β-strand | 153 | 1 | 2 |
| β-strand | 156-157 | 2 | 1 |
| α-helix | 174-176 | 3 | |
| β-strand | 179 | 1 | 2 |
| β-strand | 180-186 | 7 | 1 |
| α-helix | 200-212 | 13 | |
| β-strand | 218-225 | 8 | 1 |
| α-helix | 232-246 | 15 | |
| β-strand | 250-256 | 7 | 1 |
| α-helix | 270-281 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endoglucanase H | A | protein | 290 | CLOSTRIDIUM THERMOCELLUM | P16218 (AlphaFold model) |
>2BV9_1 ENDOGLUCANASE H (chains A) MASNYNSGLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYN NGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIG YSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYT SIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKPIIIAEFASAEIGGNKARWITEAY NSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGALEHHHHHH
How Family 26 Glycoside Hydrolases Orchestrate Catalysis on Different Polysaccharides: Structure and Activity of a Clostridium Thermocellum Lichenase, Ctlic26A. Taylor, E.J., Goyal, A., Guerreiro, C.I.P.D. et al. J Biol Chem (2005) 280:32761. DOI 10.1074/JBC.M506580200 · PubMed
Other PDB entries of the same protein (UniProt P16218 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2BV9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.