2V3G: Family 26 lichenase

Name: PDB 2V3G: Structure of a family 26 lichenase in complex with noeuromycin
Published: 2007-09-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hydrolase

Structure of a family 26 lichenase in complex with noeuromycin. Determined by X-ray diffraction at 1.2 Å resolution. Released 18 Sept 2007.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: CLOSTRIDIUM THERMOCELLUM
Chains: 1
Atoms: 2,826
Mol. weight: 32.52 kDa
Ligands: BGC, NOY
Released: 18 Sept 2007

Explore 2V3G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V3G contains 9 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	10-14	5	1
α-helix	21-31	11
β-strand	37-43	7	1
α-helix	48-60	13
β-strand	64-70	7	1
α-helix	76-80	5
α-helix	85-98	14
β-strand	102-106	5	1
α-helix	128-144	17
β-strand	150-152	3	1
β-strand	153	1	2
β-strand	156-157	2	1
α-helix	174-176	3
β-strand	179	1	2
β-strand	180-186	7	1
α-helix	200-211	12
β-strand	218-225	8	1
α-helix	232-246	15
β-strand	250-256	7	1
β-strand	259	1	3
β-strand	263	1	3
α-helix	270-279	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endoglucanase H	A	protein	283	CLOSTRIDIUM THERMOCELLUM	P16218 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2V3G_1 ENDOGLUCANASE H (chains A)
MASNYNSGLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYN
NGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIG
YSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYT
SIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKPIIIAEFASAEIGGNKARWITEAY
NSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGAG

Ligands and cofactors

ID	Name	Formula	Copies
BGC	beta-D-glucopyranose	C6 H12 O6	1
NOY	(2R,3S,4R,5R)-5-(hydroxymethyl)piperidine-2,3,4-triol	C6 H13 N O4	1

Primary citation

D-Glucosylated Derivatives of Isofagomine and Noeuromycin and Their Potential as Inhibitors of Beta-Glycoside Hydrolases. Meloncelli, P.J., Gloster, T.M., Money, V.A. et al. To be published.

Other PDB entries of the same protein (UniProt P16218 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CIP 1.4 Å, Structure of the Michaelis complex of a family 26 lichenase
2CIT 1.4 Å, Structure of the covalent intermediate of a family 26 lichenase
6R3M 1.45 Å, Family 11 Carbohydrate-Binding Module from Clostridium thermocellum in complex with…
2BV9 1.5 Å, How family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides.…
2VI0 1.51 Å, Lichenase CtLic26 in complex with a thio-oligosaccharide
2BVD 1.6 Å, How family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides.…
1V0A 1.98 Å, Family 11 Carbohydrate-Binding Module of cellulosomal cellulase Lic26A-Cel5E of…
4U3A 2.42 Å, Crystal structure of CtCel5E
4U5I 2.5 Å, Complex structure of mutant CtCel5E (E314A) with xylobiose
5BYW 2.6 Å, Crystal structure of engineered trifunctional CtCEL5E
6R31 2.6 Å, Family 11 Carbohydrate-Binding Module from Clostridium thermocellum in complex with…
4U5K 2.65 Å, Complex structure of mutant CtCel5E (E314A) with cellobiose

Browse structure collections

About this viewer

MolViewer shows 2V3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.