4U5I: Endoglucanase H

Complex structure of mutant CtCel5E (E314A) with xylobiose. Determined by X-ray diffraction at 2.5 Å resolution. Released 14 Jan 2015.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Clostridium thermocellum ATCC 27405
Chains: 2
Atoms: 5,213
Mol. weight: 92.95 kDa
Released: 14 Jan 2015

Explore 4U5I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U5I contains 26 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	78-85	8
β-strand	87-90	4	1
α-helix	105-107	3
α-helix	109-118	10
β-strand	122-125	4	1
α-helix	130-132	3
β-strand	133	1	2
α-helix	140	1
β-strand	141	1	2
α-helix	142	1
α-helix	143-158	16
β-strand	162-165	4	1
α-helix	172-175	4
α-helix	177-194	18
β-strand	202-205	4	1
β-strand	212	1	3
β-strand	214	1	3
α-helix	216-233	18
β-strand	239-246	8	1
β-strand	250-254	5	1
β-strand	263-269	7	1
β-strand	283	1	4
α-helix	286-306	21
β-strand	310-315	6	1
β-strand	320	1	4
α-helix	323-339	17
β-strand	343-346	4	1
β-strand	362-363	2	5
β-strand	368-369	2	5
α-helix	371-377	7

Chain B: 13 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	78-85	8
β-strand	87-90	4	1
α-helix	105-107	3
α-helix	109-118	10
β-strand	122-125	4	1
α-helix	130-132	3
β-strand	133	1	6
α-helix	140	1
β-strand	141	1	6
α-helix	142	1
α-helix	143-158	16
β-strand	162-166	5	1
α-helix	172-175	4
α-helix	177-195	19
β-strand	202-205	4	1
β-strand	212	1	7
β-strand	214	1	7
α-helix	216-233	18
β-strand	239-246	8	1
β-strand	250-254	5	1
β-strand	263-269	7	1
β-strand	283	1	8
α-helix	286-306	21
β-strand	310-315	6	1
β-strand	320	1	8
α-helix	323-339	17
β-strand	343-346	4	1
β-strand	362-363	2	9
β-strand	368-369	2	9
α-helix	371-377	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endoglucanase H	A, B	protein	403	Clostridium thermocellum ATCC 27405	P16218 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4U5I_1 Endoglucanase H (chains A, B)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRIEGREFSSPEALAAYREAIGAGSSNPTP
TPTWTSTPPSSSPKAVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAMEYYFDDFKAAGY
KNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHHDDWIKEDYNGN
IERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKIIRKTNPTRIVI
IGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYEFTHKWRGTWGTQEDMDTVVRVFDFVK
SWSDRNNIPVYFGAFAVMAYADRTSRVKWYDFISDAALERGFACSVWDNGVFGSLDNDMA
IYNRDTRTFDTEILNALFNPGTYPSYSPKPSPTPRPTKPPVTP

Primary citation

Biochemical Characterization and Structural Analysis of a Bifunctional Cellulase/Xylanase from Clostridium thermocellum. Yuan, S.F., Wu, T.H., Lee, H.L. et al. J Biol Chem (2015) 290:5739-5748. DOI 10.1074/jbc.M114.604454 · PubMed

Other PDB entries of the same protein (UniProt P16218 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V3G 1.2 Å, Structure of a family 26 lichenase in complex with noeuromycin
2CIP 1.4 Å, Structure of the Michaelis complex of a family 26 lichenase
2CIT 1.4 Å, Structure of the covalent intermediate of a family 26 lichenase
6R3M 1.45 Å, Family 11 Carbohydrate-Binding Module from Clostridium thermocellum in complex with…
2BV9 1.5 Å, How family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides.…
2VI0 1.51 Å, Lichenase CtLic26 in complex with a thio-oligosaccharide
2BVD 1.6 Å, How family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides.…
1V0A 1.98 Å, Family 11 Carbohydrate-Binding Module of cellulosomal cellulase Lic26A-Cel5E of…
4U3A 2.42 Å, Crystal structure of CtCel5E
5BYW 2.6 Å, Crystal structure of engineered trifunctional CtCEL5E
6R31 2.6 Å, Family 11 Carbohydrate-Binding Module from Clostridium thermocellum in complex with…
4U5K 2.65 Å, Complex structure of mutant CtCel5E (E314A) with cellobiose

Browse structure collections

About this viewer

MolViewer shows 4U5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.