Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase. Determined by X-ray diffraction at 1.5 Å resolution. Released 2 Jun 1999.
Explore 2BVV in 3D Show helices and sheets RCSB PDB PDBe
2BVV contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 15-20 | 6 | 2 |
| β-strand | 25-31 | 7 | 2 |
| β-strand | 35-42 | 8 | 1 |
| β-strand | 50-61 | 12 | 2 |
| β-strand | 64-73 | 10 | 1 |
| β-strand | 77-85 | 9 | 1 |
| β-strand | 93-100 | 8 | 1 |
| β-strand | 103-116 | 14 | 1 |
| β-strand | 122-132 | 11 | 1 |
| α-helix | 135-137 | 3 | |
| β-strand | 142-145 | 4 | 2 |
| α-helix | 146-155 | 10 | |
| α-helix | 159-161 | 3 | |
| β-strand | 163-174 | 12 | 1 |
| β-strand | 177-184 | 8 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (endo-1,4-beta-xylanase) | A | protein | 185 | Bacillus circulans | P09850 (AlphaFold model) |
>2BVV_1 PROTEIN (ENDO-1,4-BETA-XYLANASE) (chains A) ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAP NGNGYLTLFGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG DRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSS NVTVW
Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase. Sidhu, G., Withers, S.G., Nguyen, N.T. et al. Biochemistry (1999) 38:5346-5354. DOI 10.1021/bi982946f · PubMed
Other PDB entries of the same protein (UniProt P09850 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2BVV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.