2BYS: ACHBP FROM APLYSIA CALIFORNICA

CRYSTAL STRUCTURE OF ACHBP FROM APLYSIA CALIFORNICA IN complex with lobeline. Determined by X-ray diffraction at 2.05 Å resolution. Released 5 Oct 2005.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: APLYSIA CALIFORNICA
Chains: 10
Atoms: 18,491
Mol. weight: 261.9 kDa
Ligands: LOB
Released: 5 Oct 2005

Explore 2BYS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BYS contains 36 α-helices and 150 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
β-strand	29-44	16	1
β-strand	49-66	18	1
α-helix	69-71	3
β-strand	77-81	5	1
α-helix	82-84	3
β-strand	90-92	3	2
β-strand	95	1	1
β-strand	100-101	2	1
β-strand	106-110	5	1
β-strand	112-117	6	1
β-strand	120-126	7	1
β-strand	138-146	9	2
β-strand	154-158	5	1
β-strand	162	1	2
β-strand	164	1	1
β-strand	174-187	14	2
β-strand	194-206	13	2

Chain B: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	1-14	14
β-strand	29-44	16	3
β-strand	49-61	13	3
α-helix	63-65	3
α-helix	69-71	3
β-strand	77-81	5	3
α-helix	82-84	3
β-strand	90-92	3	4
β-strand	95	1	3
α-helix	98-99	2
β-strand	100-101	2	3
β-strand	106-110	5	3
β-strand	114-117	4	3
β-strand	120-126	7	3
β-strand	138-146	9	4
β-strand	154-157	4	3
β-strand	162	1	4
α-helix	163	1
β-strand	164	1	3
β-strand	174-188	15	4
β-strand	191-206	16	4

Chains C and J: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
β-strand	29-44	16	5
β-strand	49-66	18	5
α-helix	69-72	4
β-strand	77-81	5	5
α-helix	82-84	3
β-strand	90-92	3	6
β-strand	95	1	5
β-strand	100-101	2	5
β-strand	106-110	5	5
β-strand	112-117	6	5
β-strand	120-126	7	5
β-strand	138-146	9	6
β-strand	154-157	4	5
β-strand	162	1	6
β-strand	164	1	5
β-strand	174-188	15	6
β-strand	191-206	16	6

Chain D: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	1-14	14
β-strand	29-44	16	7
β-strand	49-66	18	7
α-helix	69-72	4
β-strand	77-81	5	7
α-helix	82-84	3
β-strand	90-92	3	8
β-strand	95	1	7
β-strand	100-101	2	7
β-strand	106-110	5	7
β-strand	112-117	6	7
β-strand	120-126	7	7
β-strand	138-146	9	8
β-strand	154-157	4	7
β-strand	162	1	8
β-strand	164	1	7
β-strand	174-186	13	8
β-strand	195-206	12	8

Chain E: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	0-14	15
β-strand	29-44	16	9
β-strand	49-66	18	9
α-helix	69-72	4
β-strand	77-81	5	9
α-helix	82-84	3
β-strand	90-92	3	10
β-strand	95	1	9
β-strand	100-101	2	9
β-strand	106-110	5	9
β-strand	112-117	6	9
β-strand	120-126	7	9
β-strand	138-146	9	10
β-strand	154-157	4	9
β-strand	162	1	10
β-strand	164	1	9
β-strand	174-188	15	10
β-strand	191-206	16	10

Chain F: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
β-strand	29-44	16	11
β-strand	49-66	18	11
α-helix	69-72	4
β-strand	77-81	5	11
α-helix	82-84	3
β-strand	90-92	3	12
β-strand	95	1	11
β-strand	100-101	2	11
β-strand	106-110	5	11
β-strand	112-117	6	11
β-strand	120-126	7	11
β-strand	138-146	9	12
β-strand	154-157	4	11
β-strand	162	1	12
β-strand	164	1	11
β-strand	174-187	14	12
β-strand	194-206	13	12

Chain G: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
β-strand	29-44	16	13
β-strand	49-66	18	13
α-helix	69-71	3
β-strand	77-81	5	13
α-helix	82-84	3
β-strand	90-92	3	14
β-strand	95	1	13
α-helix	98-99	2
β-strand	100-101	2	13
β-strand	106-110	5	13
β-strand	112-117	6	13
β-strand	120-126	7	13
β-strand	138-146	9	14
β-strand	154-157	4	13
β-strand	162	1	14
α-helix	163	1
β-strand	164	1	13
β-strand	174-188	15	14
β-strand	191-206	16	14

Chain H: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-14	13
β-strand	29-44	16	15
β-strand	49-66	18	15
α-helix	69-72	4
β-strand	77-81	5	15
α-helix	82-84	3
β-strand	90-92	3	16
β-strand	95	1	15
β-strand	100-101	2	15
β-strand	106-110	5	15
β-strand	112-117	6	15
β-strand	120-126	7	15
β-strand	138-146	9	16
β-strand	154-157	4	15
β-strand	162	1	16
β-strand	164	1	15
β-strand	174-188	15	16
β-strand	191-206	16	16

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine-binding protein	A, B, C, D, E, F, G, H, I, J	protein	227	APLYSIA CALIFORNICA	Q8WSF8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>2BYS_1 ACETYLCHOLINE-BINDING PROTEIN (chains A, B, C, D, E, F, G, H, I, J)
YKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDL
VYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHD
GSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASS
KYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD

Ligands and cofactors

ID	Name	Formula	Copies
LOB	Lobeline	C22 H27 N O2	10

Primary citation

Structures of Aplysia Achbp Complexes with Nicotinic Agonists and Antagonists Reveal Distinctive Binding Interfaces and Conformations. Hansen, S.B., Sulzenbacher, G., Huxford, T. et al. EMBO J (2005) 24:3635. DOI 10.1038/SJ.EMBOJ.7600828 · PubMed

Other PDB entries of the same protein (UniProt Q8WSF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6T9R 1.72 Å, Aplysia californica AChBP in complex with a cytisine derivative
2WN9 1.75 Å, Crystal structure of Aplysia ACHBP in complex with 4-0H-DMXBA
2PGZ 1.76 Å, Crystal structure of Cocaine bound to an ACh-Binding Protein
2WNJ 1.8 Å, Crystal structure of aplysia achbp in complex with dmxba
8QTL 1.85 Å, Aplysia californica acetylcholine-binding protein in complex with Spiroimine (-)-4 S
2Y7Y 1.9 Å, Aplysia californica achbp in apo state
4XHE 1.9 Å, Crystal Structure of A-AChBP in complex with pinnatoxin A
4ZK4 1.9 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
2XYS 1.91 Å, Crystal structure of Aplysia californica AChBP in complex with strychnine
5TVC 1.93 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
3C84 1.94 Å, Crystal structure of a complex of AChBP from aplysia californica and the neonicotinoid…
2YMD 1.96 Å, Crystal structure of a mutant binding protein (5HTBP-AChBP) in complex with serotonin…

Browse structure collections

About this viewer

MolViewer shows 2BYS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.