2BZF: Barrier-to-autointegration factor

Structural basis for DNA bridging by barrier-to-autointegration factor (BAF). Determined by X-ray diffraction at 2.87 Å resolution. Released 15 Sept 2005.

Method: X-ray diffraction
Resolution: 2.87 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 983
Mol. weight: 14.31 kDa
Released: 15 Sept 2005

Explore 2BZF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BZF contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	5-12	8
α-helix	20-22	3
α-helix	28-36	9
α-helix	42-51	10
α-helix	56-66	11
α-helix	71-88	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Barrier-to-autointegration factor	A	protein	89	HOMO SAPIENS	O75531 (AlphaFold model)
5'-d(gptpgpgpapgp*gp)-3'	B	DNA	7
5'-d(cpcptpcpcpap*cp)-3'	C	DNA	7

Sequence of entity 1 (A), FASTA

>2BZF_1 BARRIER-TO-AUTOINTEGRATION FACTOR (chains A)
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR
EWLKDTCGANAKQSRDCFGCLREWCDAFL

Sequence of entity 2 (B), FASTA

>2BZF_2 5'-D(*GP*TP*GP*GP*AP*GP*GP)-3' (chains B)
GTGGAGG

Sequence of entity 3 (C), FASTA

>2BZF_3 5'-D(*CP*CP*TP*CP*CP*AP*CP)-3' (chains C)
CCTCCAC

Primary citation

Structural Basis for DNA Bridging by Barrier-to-Autointegration Factor. Bradley, C.M., Ronning, D.R., Ghirlando, R. et al. Nat Struct Mol Biol (2005) 12:935. DOI 10.1038/NSMB989 · PubMed

Other PDB entries of the same protein (UniProt O75531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDY 1.44 Å, Di-phosphorylated Barrier-to-Autointegration Factor (BAF) in complex with LEM domain of…
7Z21 1.63 Å, BAF A12T bound to the lamin A/C Ig-fold domain
6URE 1.65 Å, Barrier-to-autointegration factor Aqueous: 1 of 14 in MSCS set
6URJ 1.65 Å, Barrier-to-autointegration factor soaked in Acetone: 1 of 14 in MSCS set
6URZ 1.65 Å, Barrier-to-autointegration factor soaked in methanol: 1 of 14 in MSCS set
6US0 1.65 Å, Barrier-to-autointegration factor soaked in R,S,R-bisfuranol (RSR): 1 of 14 in MSCS set
6US1 1.65 Å, Barrier-to-autointegration factor soaked in isobutanol: 1 of 14 in MSCS set
6US7 1.65 Å, Barrier-to-autointegration factor soaked in TMAO: 1 of 14 in MSCS set
6USD 1.65 Å, Barrier-to-autointegration factor soaked in ethanol: 1 of 14 in MSCS set
6USI 1.65 Å, Barrier-to-autointegration factor soaked in 1,6-hexanediol: 1 of 14 in MSCS set
6URN 1.68 Å, Barrier-to-autointegration factor t-butanol: 1 of 14 in MSCS set
6USB 1.68 Å, Barrier-to-autointegration factor soaked in urea: 1 of 14 in MSCS set

Browse structure collections

About this viewer

MolViewer shows 2BZF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.