2C46: MRNA capping enzyme

Name: PDB 2C46: CRYSTAL STRUCTURE OF THE HUMAN RNA guanylyltransferase and 5'- phosphatase
Published: 2005-11-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

CRYSTAL STRUCTURE OF THE HUMAN RNA guanylyltransferase and 5'- phosphatase. Determined by X-ray diffraction at 1.6 Å resolution. Released 1 Nov 2005.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 6,719
Mol. weight: 110.75 kDa
Released: 1 Nov 2005

Explore 2C46 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C46 contains 64 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	-4--2	3
α-helix	5-7	3
β-strand	16	1	1
α-helix	18-19	2
β-strand	20	1	1
β-strand	24-27	4	1
α-helix	28-30	3
α-helix	33-38	6
α-helix	41-43	3
α-helix	47-57	11
β-strand	60-66	7	1
α-helix	77-80	4
β-strand	85-88	4	1
α-helix	90-92	3
α-helix	96-99	4
α-helix	100-110	11
β-strand	120-125	6	1
α-helix	131-143	13
α-helix	149-159	11
α-helix	167-177	11
α-helix	180-182	3
α-helix	183-190	8

Chain B: 17 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	-4--2	3
α-helix	5-7	3
β-strand	16	1	2
α-helix	18-19	2
β-strand	20	1	2
β-strand	24-27	4	2
α-helix	28-30	3
α-helix	33-35	3
α-helix	41-43	3
α-helix	47-57	11
β-strand	61-66	6	2
α-helix	77-80	4
β-strand	85-88	4	2
α-helix	90-92	3
α-helix	96-98	3
α-helix	100-115	16
β-strand	121-125	5	2
α-helix	131-145	15
α-helix	149-159	11
α-helix	167-177	11
α-helix	180-182	3
α-helix	183-190	8
α-helix	191-193	3

Chain C: 17 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	-4--2	3
α-helix	5-7	3
β-strand	16	1	3
α-helix	18-19	2
β-strand	20	1	3
β-strand	24-27	4	3
α-helix	28-30	3
α-helix	33-38	6
α-helix	41-43	3
α-helix	47-56	10
β-strand	61-66	6	3
α-helix	76-80	5
β-strand	85-88	4	3
α-helix	90-92	3
α-helix	96-99	4
α-helix	100-111	12
β-strand	121-125	5	3
α-helix	131-145	15
α-helix	149-159	11
α-helix	167-177	11
α-helix	180-182	3
α-helix	183-190	8
α-helix	191-193	3

Chain D: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	16	1	4
β-strand	20	1	4
β-strand	24-27	4	4
α-helix	28-30	3
α-helix	33-38	6
α-helix	41-43	3
α-helix	47-55	9
β-strand	61-66	6	4
α-helix	77-80	4
β-strand	85-88	4	4
α-helix	90-92	3
α-helix	96-99	4
α-helix	100-111	12
β-strand	121-125	5	4
α-helix	131-145	15
α-helix	149-159	11
α-helix	167-177	11
α-helix	180-182	3
α-helix	183-190	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mRNA capping enzyme	A, B, C, D	protein	241	HOMO SAPIENS	O60942 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2C46_1 MRNA CAPPING ENZYME (chains A, B, C, D)
MHHHHHHSSGVDLGTENLYFQSMAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQ
VAEENRFHPSMLSNYLKSLKVKMGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECP
TTENTETFIRLCERFNERNPPELIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQ
ARPPGIYKGDYLKELFRRYGDIEEAPPPPLLPDWCFEDDEDEDEDEDGKKESETGSSASF
G

Primary citation

Crystal Structure of the Human RNA Guanylyltransferase and 5'-Phosphatase. Debreczeni, J., Johansson, C., Longman, E. et al. To be published.

Other PDB entries of the same protein (UniProt O60942 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3S24 3.01 Å, Crystal structure of human mRNA guanylyltransferase
8P4B 3.2 Å, Structural insights into human co-transcriptional capping - structure 2
8P4A 3.6 Å, Structural insights into human co-transcriptional capping - structure 1
8P4D 3.6 Å, Structural insights into human co-transcriptional capping - structure 4
8P4C 3.8 Å, Structural insights into human co-transcriptional capping - structure 3
8P4E 3.9 Å, Structural insights into human co-transcriptional capping - structure 5
8W8E 3.9 Å, human co-transcriptional RNA capping enzyme RNGTT
8W8F 4.0 Å, human co-transcriptional RNA capping enzyme RNGTT-CMTR1

Browse structure collections

About this viewer

MolViewer shows 2C46 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.