2C9O: Human RuvB-like helicase RuvBL1

3D Structure of the human RuvB-like helicase RuvBL1. Determined by X-ray diffraction at 2.2 Å resolution. Released 23 Oct 2006.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 8,706
Mol. weight: 152.17 kDa
Ligands: ADP
Released: 23 Oct 2006

Explore 2C9O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C9O contains 67 α-helices and 64 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	10-16	7
β-strand	26	1	1
α-helix	31	1
β-strand	32	1	1
α-helix	33	1
β-strand	35-36	2	2
β-strand	39-40	2	2
α-helix	43-57	15
β-strand	65-69	5	3
α-helix	76-87	12
β-strand	93-97	5	3
α-helix	98-101	4
α-helix	108-118	11
β-strand	120-140	21	4
β-strand	157-163	7	4
β-strand	166-172	7	4
α-helix	174-182	9
β-strand	189-194	6	4
β-strand	200-206	7	4
β-strand	220-221	2	4
α-helix	222-225	4
β-strand	229-239	11	4
α-helix	240-245	6
α-helix	278-288	11
β-strand	292-296	5	4
β-strand	298-302	5	3
α-helix	304-306	3
β-strand	308	1	5
α-helix	309-318	10
α-helix	324-325	2
β-strand	326-331	6	3
β-strand	335-337	3	6
α-helix	338	1
β-strand	339	1	5
β-strand	345-347	3	6
α-helix	352-355	4
β-strand	358-362	5	3
α-helix	365-367	3
α-helix	368-382	15
β-strand	386	1	7
α-helix	388-400	13
α-helix	403-408	6
α-helix	410-419	10
β-strand	425	1	7
α-helix	427-436	10
α-helix	440-448	9

Chain B: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	12-18	7
β-strand	35-36	2	8
β-strand	39-40	2	8
α-helix	43-57	15
β-strand	65-69	5	9
α-helix	76-87	12
β-strand	93-97	5	9
α-helix	98-101	4
α-helix	108-118	11
β-strand	120-140	21	10
β-strand	157-163	7	10
β-strand	166-172	7	10
α-helix	174-182	9
β-strand	189-194	6	10
β-strand	200-206	7	10
α-helix	207-209	3
β-strand	215-217	3	4
β-strand	220-221	2	10
α-helix	222-224	3
β-strand	229-239	11	10
α-helix	240-243	4
α-helix	280-288	9
β-strand	292-296	5	10
β-strand	298-302	5	9
α-helix	304-306	3
β-strand	308	1	11
α-helix	309-318	10
α-helix	324-325	2
β-strand	326-331	6	9
β-strand	335-337	3	12
α-helix	338	1
β-strand	339	1	11
β-strand	345-347	3	12
α-helix	352-355	4
β-strand	358-362	5	9
α-helix	365-367	3
α-helix	368-382	15
β-strand	386	1	13
α-helix	388-400	13
α-helix	403-408	6
α-helix	410-419	10
β-strand	425	1	13
α-helix	427-436	10
α-helix	440-447	8

Chain C: 22 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
α-helix	16-18	3
β-strand	26	1	14
α-helix	31	1
β-strand	32	1	14
α-helix	33	1
β-strand	35-36	2	15
β-strand	39-40	2	15
α-helix	43-57	15
β-strand	65-69	5	16
α-helix	76-87	12
β-strand	93-97	5	16
α-helix	98-101	4
α-helix	108-118	11
β-strand	120-127	8	17
β-strand	232-238	7	17
α-helix	239-243	5
α-helix	279-288	10
β-strand	292-296	5	17
β-strand	298-302	5	16
α-helix	304-306	3
β-strand	308	1	18
α-helix	309-319	11
α-helix	324-325	2
β-strand	326-331	6	16
β-strand	335-337	3	19
α-helix	338	1
β-strand	339	1	18
β-strand	345-347	3	19
α-helix	352-355	4
β-strand	358-362	5	16
α-helix	365-367	3
α-helix	368-381	14
β-strand	386	1	20
α-helix	388-400	13
α-helix	403-408	6
α-helix	410-419	10
β-strand	425	1	20
α-helix	427-436	10
β-strand	438	1	9
α-helix	440-448	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ruvb-like 1	A, B, C	protein	456	HOMO SAPIENS	Q9Y265 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2C9O_1 RUVB-LIKE 1 (chains A, B, C)
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKK
MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAI
GLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESL
QKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTL
HDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI
IRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	3

Primary citation

Crystal structure of the human AAA+ protein RuvBL1. Matias, P.M., Gorynia, S., Donner, P. et al. J Biol Chem (2006) 281:38918-38929. DOI 10.1074/jbc.M605625200 · PubMed

Other PDB entries of the same protein (UniProt Q9Y265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QR1 2.4 Å, Cryo-EM structure of the human Tip60 complex
9EMA 2.4 Å, RUVBL1/2 in complex with ATP and CB-6644 inhibitor
6K0R 2.5 Å, Ruvbl1-Ruvbl2 with truncated domain II in complex with phosphorylated Cordycepin
9C57 2.75 Å, Reconstituted P400 Subcomplex of the human TIP60 complex
2XSZ 3.0 Å, The dodecameric human RuvBL1:RuvBL2 complex with truncated domains II
9CAE 3.07 Å, Cryo-EM structure of the reconstituted RuvBL lobe of the human TIP60 complex (composite…
7ZI4 3.2 Å, Cryo-EM structure of the human INO80 complex bound to a WT nucleosome
8X15 3.2 Å, Structure of nucleosome-bound SRCAP-C in the apo state
8X19 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
8X1C 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-bound state
8XVT 3.2 Å, The core subcomplex of human NuA4/TIP60 complex
9SN2 3.2 Å, Cryo-EM reconstruction of the RUVBL1-RUVBL2-CCDC103 (R2C) complex

Browse structure collections

About this viewer

MolViewer shows 2C9O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.