Crystal structure analysis of a fluorescent form of H-ras P21 in complex with GTP. Determined by X-ray diffraction at 1.25 Å resolution. Released 24 May 2006.
Explore 2CL7 in 3D Show helices and sheets RCSB PDB PDBe
2CL7 contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 1 |
| α-helix | 16-25 | 10 | |
| β-strand | 38-46 | 9 | 1 |
| β-strand | 49-57 | 9 | 1 |
| α-helix | 66-72 | 7 | |
| β-strand | 77-83 | 7 | 1 |
| α-helix | 87-104 | 18 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-144 | 4 | 1 |
| α-helix | 152-165 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gtpase HRAS | X | protein | 166 | HOMO SAPIENS | P01112 (AlphaFold model) |
>2CL7_1 GTPASE HRAS (chains X) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
| ID | Name | Formula | Copies |
|---|---|---|---|
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 1 |
| XY2 | N,n'-dimethyl-N-(acetyl)-N'-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)ethylenediamine | C12 H15 N5 O4 | 1 |
| MG | Magnesium ion | Mg | 2 |
A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction. Klink, B.U., Goody, R.S., Scheidig, A.J. Biophys J (2006) 91:981. DOI 10.1529/BIOPHYSJ.105.078931 · PubMed
Other PDB entries of the same protein (UniProt P01112 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2CL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.