The complement inhibitor OmCI in complex with ricinoleic acid. Determined by X-ray diffraction at 1.9 Å resolution. Released 1 May 2007.
Explore 2CM4 in 3D Show helices and sheets RCSB PDB PDBe
2CM4 contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 32-35 | 4 | |
| α-helix | 37-39 | 3 | |
| β-strand | 43-48 | 6 | 1 |
| α-helix | 53-54 | 2 | |
| β-strand | 58-61 | 4 | 1 |
| β-strand | 66 | 1 | 1 |
| β-strand | 69-78 | 10 | 1 |
| β-strand | 81-92 | 12 | 1 |
| β-strand | 95-100 | 6 | 1 |
| β-strand | 103-112 | 10 | 1 |
| β-strand | 118-124 | 7 | 1 |
| β-strand | 129-135 | 7 | 1 |
| α-helix | 141-154 | 14 | |
| β-strand | 161 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Complement inhibitor | A | protein | 150 | ORNITHODOROS MOUBATA | Q5YD59 (AlphaFold model) |
>2CM4_1 COMPLEMENT INHIBITOR (chains A) DSESDCTGSEPVDAFQAFSEGKEAYVLVRSTDPKARDCLKGEPAGEKQDNTLPVMMTFKQ GTDWASTDWTFTLDGAKVTATLGQLTQNREVVYDSQSHHCHVDKVEKEVPDYEMWMLDAG GLEVEVECCRQKLEELASGRNQMYPHLKDC
| ID | Name | Formula | Copies |
|---|---|---|---|
| RCL | Ricinoleic acid | C18 H34 O3 | 1 |
Water and common crystallization additives (ACT) are not listed.
The Structure of Omci, a Novel Lipocalin Inhibitor of the Complement System. Roversi, P., Lissina, O., Johnson, S. et al. J Mol Biol (2007) 369:784. DOI 10.1016/J.JMB.2007.03.064 · PubMed
Other PDB entries of the same protein (UniProt Q5YD59 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2CM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.