5HCE: Complement C5

Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Rhipicephalus appendiculatus RaCI1. Determined by X-ray diffraction at 3.12 Å resolution. Released 30 Mar 2016.

Method: X-ray diffraction
Resolution: 3.12 Å
Organisms: Homo sapiens, Ornithodoros moubata, Rhipicephalus appendiculatus
Chains: 4
Atoms: 14,418
Mol. weight: 213.82 kDa
Ligands: CYS
Released: 30 Mar 2016

Explore 5HCE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HCE contains 57 α-helices and 128 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 57 β-strands

Element	Residues	Length	Sheet
α-helix	681-689	9
α-helix	697-702	6
α-helix	711-715	5
α-helix	722-738	17
α-helix	744-757	14
β-strand	764-765	2	7
α-helix	770-772	3
β-strand	773	1	15
β-strand	777-780	4	15
β-strand	783-789	7	14
β-strand	795-805	11	15
β-strand	808-811	4	15
α-helix	812-814	3
β-strand	815-819	5	15
β-strand	823-828	6	16
β-strand	833-834	2	17
β-strand	838-847	10	16
β-strand	853-859	7	17
α-helix	860-862	3
β-strand	865-867	3	16
β-strand	886-888	3	17
α-helix	889	1
β-strand	892-902	11	16
β-strand	906-916	11	17
β-strand	919-930	12	17
β-strand	934-944	11	18
β-strand	945	1	19
β-strand	954	1	19
β-strand	956-959	4	20
β-strand	967	1	18
α-helix	968	1
β-strand	974-980	7	18
α-helix	985-992	8
α-helix	1004	1
α-helix	1008-1013	6
α-helix	1016-1027	12
α-helix	1031-1033	3
α-helix	1038-1054	17
α-helix	1057-1059	3
β-strand	1060	1	21
β-strand	1066	1	21
β-strand	1067	1	22
β-strand	1074	1	22
α-helix	1076-1089	14
α-helix	1097-1110	14
β-strand	1112	1	23
β-strand	1118	1	23
β-strand	1130	1	24
α-helix	1133-1154	22
α-helix	1162-1178	17
α-helix	1180	1
α-helix	1182	1
α-helix	1185-1196	12
α-helix	1203-1214	12
β-strand	1217-1220	4	25
β-strand	1223-1227	5	25
α-helix	1238-1240	3
α-helix	1245-1260	16
α-helix	1264-1276	13
α-helix	1287-1303	17
β-strand	1310-1317	8	20
β-strand	1324-1329	6	20
β-strand	1338-1339	2	18
β-strand	1346-1350	5	20
β-strand	1354	1	20
β-strand	1357-1367	11	18
α-helix	1374-1375	2
β-strand	1377-1384	8	26
β-strand	1401-1408	8	26
β-strand	1414	1	24
β-strand	1422-1427	6	27
α-helix	1428-1429	2
β-strand	1432-1434	3	28
α-helix	1436-1443	8
β-strand	1452-1456	5	27
β-strand	1459-1464	6	27
β-strand	1473-1478	6	26
β-strand	1479-1481	3	28
β-strand	1485-1486	2	16
α-helix	1488-1490	3
β-strand	1491-1497	7	27
β-strand	1500-1509	10	27
β-strand	1535	1	29
α-helix	1536-1537	2
α-helix	1547-1550	4
β-strand	1559-1571	13	29
β-strand	1574-1587	14	29
β-strand	1597-1603	7	29
β-strand	1616-1621	6	29
β-strand	1625-1629	5	29
β-strand	1632-1638	7	29
β-strand	1644-1647	4	29
α-helix	1657-1672	16

Chain B: 16 helices, 55 β-strands

Element	Residues	Length	Sheet
β-strand	22-28	7	1
β-strand	31-32	2	2
β-strand	36-44	9	1
β-strand	50-58	9	3
β-strand	65-73	9	3
β-strand	80-86	7	1
α-helix	89-91	3
β-strand	101-108	8	3
β-strand	112-118	7	3
β-strand	119-120	2	2
β-strand	125-130	6	4
β-strand	134-135	2	5
β-strand	140-141	2	6
β-strand	143-148	6	4
β-strand	154	1	4
β-strand	159-164	6	5
β-strand	170-176	7	5
β-strand	182-184	3	4
α-helix	186-187	2
β-strand	188-189	2	6
α-helix	190-191	2
β-strand	197-205	9	5
β-strand	212-219	8	5
β-strand	221-222	2	7
β-strand	227-233	7	8
β-strand	237-238	2	8
β-strand	246-254	9	8
β-strand	258-259	2	8
β-strand	262-272	11	8
β-strand	281-283	3	8
β-strand	289-293	5	8
β-strand	296-301	6	8
α-helix	303-306	4
β-strand	322-331	10	8
β-strand	337-347	11	8
β-strand	353-356	4	9
β-strand	362-363	2	10
α-helix	368	1
β-strand	369-376	8	9
β-strand	382	1	9
β-strand	387-396	10	10
β-strand	401-403	3	10
α-helix	404-406	3
β-strand	407-410	4	10
β-strand	417-422	6	9
β-strand	428-437	10	10
β-strand	449-456	8	10
α-helix	457-458	2
β-strand	464-468	5	11
α-helix	475	1
β-strand	476	1	12
α-helix	477	1
β-strand	481-489	9	11
α-helix	493-495	3
β-strand	498-505	8	13
β-strand	508-516	9	13
α-helix	517-518	2
β-strand	524-529	6	11
α-helix	532-534	3
β-strand	537-546	10	13
β-strand	553-562	10	13
β-strand	563	1	12
β-strand	571-576	6	14
β-strand	582	1	15
β-strand	587-594	8	14
β-strand	598-606	9	15
α-helix	607-610	4
α-helix	623-627	5
α-helix	642-648	7
β-strand	651-655	5	1
α-helix	668-669	2

Chain C: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	32-35	4
α-helix	37-39	3
β-strand	43-48	6	30
α-helix	53-54	2
β-strand	55-61	7	30
β-strand	66	1	30
β-strand	69-78	10	30
β-strand	81-92	12	30
β-strand	95-100	6	30
β-strand	103-112	10	30
β-strand	118-123	6	30
β-strand	129-135	7	30
β-strand	139-140	2	25
α-helix	141-155	15
β-strand	161	1	30
α-helix	163-165	3

Chain D: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	19-23	5	31
β-strand	29-31	3	31
β-strand	39-41	3	32
β-strand	51-53	3	31
β-strand	54-56	3	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5	B	protein	656	Homo sapiens	P01031 (AlphaFold model)
Complement C5	A	protein	998	Homo sapiens	P01031 (AlphaFold model)
Complement inhibitor	C	protein	165	Ornithodoros moubata	Q5YD59 (AlphaFold model)
Rhipicephalus appendiculatus RaCI1	D	protein	81	Rhipicephalus appendiculatus	A0A141SFN4 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>5HCE_1 Complement C5 (chains B)
QEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENK
FQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPD
QSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGM
WTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNK
VVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDL
NNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYPIKVQVKDS
LDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTD
APDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITH
YNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDS
VWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKK
PLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEILR

Sequence of entity 2 (A), FASTA

>5HCE_2 Complement C5 (chains A)
LQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQL
RANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTWE
IQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCVK
MSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNINFSLETWF
GKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRILS
VKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDP
LIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQN
SICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDI
CPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREALV
KGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLNLKDINYVNPVIKWLSEEQ
RYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPV
EVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSD
YKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDG
HVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQK
VCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYK
ATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYP
LDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Sequence of entity 3 (C), FASTA

>5HCE_3 Complement inhibitor (chains C)
MASHHHHHHHHHHSGDSESDCTGSEPVDAFQAFSEGKEAYVLVRSTDPKARDCLKGEPAG
EKQDNTLPVMMTFKQGTDWASTDWTFTLDGAKVTATLGQLTQNREVVYDSQSHHCHVDKV
EKEVPDYEMWMLDAGGLEVEVECCRQKLEELASGRNQMYPHLKDC

Sequence of entity 4 (D), FASTA

>5HCE_4 Rhipicephalus appendiculatus RaCI1 (chains D)
GPMEEVKTTPIPNHQCVNATCERKLDALGNAVITKCPQGCLCVVRGASNIVPANGTCFQL
ATTKPPMAPGDNKDNKEEESN

Ligands and cofactors

ID	Name	Formula	Copies
CYS	Cysteine	C3 H7 N O2 S	1

Primary citation

Structural basis for therapeutic inhibition of complement C5. Jore, M.M., Johnson, S., Sheppard, D. et al. Nat Struct Mol Biol (2016) 23:378-386. DOI 10.1038/nsmb.3196 · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…

Browse structure collections

About this viewer

MolViewer shows 5HCE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.