2CNW: GDPALF4 complex of the SRP GTPases Ffh and FtsY
GDPALF4 complex of the SRP GTPases Ffh and FtsY. Determined by X-ray diffraction at 2.39 Å resolution. Released 11 Oct 2006.
- Method
- X-ray diffraction
- Resolution
- 2.39 Å
- Organism
- THERMUS AQUATICUS
- Chains
- 6
- Atoms
- 13,912
- Mol. weight
- 193.71 kDa
- Ligands
- GDP, MG, ALF, 5GP
- Released
- 11 Oct 2006
Explore 2CNW in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2CNW contains 75 α-helices and 54 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-14 | 8 | |
| α-helix | 24-40 | 17 | |
| α-helix | 45-60 | 16 | |
| α-helix | 70-85 | 16 | |
| β-strand | 100-104 | 5 | 1 |
| α-helix | 111-123 | 13 | |
| β-strand | 129-133 | 5 | 1 |
| α-helix | 141-152 | 12 | |
| β-strand | 156-158 | 3 | 1 |
| α-helix | 159-160 | 2 | |
| α-helix | 165-179 | 15 | |
| β-strand | 183-187 | 5 | 1 |
| α-helix | 188-190 | 3 | |
| α-helix | 196-209 | 14 | |
| β-strand | 213-219 | 7 | 1 |
| β-strand | 222 | 1 | 2 |
| α-helix | 226-236 | 11 | |
| β-strand | 241-245 | 5 | 1 |
| α-helix | 255-263 | 9 | |
| β-strand | 267-271 | 5 | 1 |
| β-strand | 279-281 | 3 | 1 |
| α-helix | 284-292 | 9 | |
Chain B: 13 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-13 | 7 | |
| α-helix | 14-16 | 3 | |
| α-helix | 26-40 | 15 | |
| α-helix | 45-61 | 17 | |
| α-helix | 70-85 | 16 | |
| β-strand | 99-104 | 6 | 3 |
| α-helix | 111-123 | 13 | |
| β-strand | 129-133 | 5 | 3 |
| α-helix | 141-152 | 12 | |
| β-strand | 156-158 | 3 | 3 |
| α-helix | 159-160 | 2 | |
| α-helix | 165-178 | 14 | |
| β-strand | 183-187 | 5 | 3 |
| α-helix | 196-209 | 14 | |
| β-strand | 213-219 | 7 | 3 |
| β-strand | 222 | 1 | 4 |
| α-helix | 226-236 | 11 | |
| β-strand | 241-245 | 5 | 3 |
| α-helix | 255-263 | 9 | |
| β-strand | 267-271 | 5 | 3 |
| β-strand | 279-281 | 3 | 3 |
| α-helix | 284-292 | 9 | |
Chain C: 14 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-14 | 8 | |
| α-helix | 24-39 | 16 | |
| α-helix | 45-61 | 17 | |
| α-helix | 64-66 | 3 | |
| α-helix | 70-85 | 16 | |
| β-strand | 99-104 | 6 | 5 |
| α-helix | 111-123 | 13 | |
| β-strand | 129-133 | 5 | 5 |
| α-helix | 141-152 | 12 | |
| β-strand | 156-158 | 3 | 5 |
| α-helix | 159-160 | 2 | |
| α-helix | 165-178 | 14 | |
| β-strand | 183-187 | 5 | 5 |
| α-helix | 188-190 | 3 | |
| α-helix | 196-209 | 14 | |
| β-strand | 213-219 | 7 | 5 |
| β-strand | 222 | 1 | 6 |
| α-helix | 226-236 | 11 | |
| β-strand | 241-245 | 5 | 5 |
| α-helix | 255-263 | 9 | |
| β-strand | 267-271 | 5 | 5 |
| β-strand | 279-281 | 3 | 5 |
| α-helix | 284-291 | 8 | |
Chain D: 13 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-41 | 14 | |
| α-helix | 46-58 | 13 | |
| α-helix | 64-75 | 12 | |
| α-helix | 80-87 | 8 | |
| α-helix | 97-100 | 4 | |
| β-strand | 104-108 | 5 | 7 |
| α-helix | 115-127 | 13 | |
| β-strand | 133-136 | 4 | 7 |
| α-helix | 145-156 | 12 | |
| β-strand | 160-161 | 2 | 7 |
| α-helix | 169-182 | 14 | |
| β-strand | 187-190 | 4 | 7 |
| α-helix | 200-216 | 17 | |
| β-strand | 223-229 | 7 | 7 |
| β-strand | 232 | 1 | 2 |
| α-helix | 235-247 | 13 | |
| β-strand | 251-255 | 5 | 7 |
| α-helix | 266-273 | 8 | |
| α-helix | 275-276 | 2 | |
| β-strand | 277-281 | 5 | 7 |
| β-strand | 289-291 | 3 | 7 |
| α-helix | 294-302 | 9 | |
Chain E: 12 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-41 | 14 | |
| α-helix | 46-56 | 11 | |
| α-helix | 65-76 | 12 | |
| α-helix | 81-88 | 8 | |
| α-helix | 90-92 | 3 | |
| β-strand | 104-108 | 5 | 8 |
| α-helix | 115-127 | 13 | |
| β-strand | 133-136 | 4 | 8 |
| α-helix | 147-156 | 10 | |
| β-strand | 160-161 | 2 | 8 |
| α-helix | 169-183 | 15 | |
| β-strand | 187-190 | 4 | 8 |
| α-helix | 200-216 | 17 | |
| β-strand | 223-229 | 7 | 8 |
| β-strand | 232 | 1 | 4 |
| α-helix | 235-247 | 13 | |
| β-strand | 251-255 | 5 | 8 |
| α-helix | 266-273 | 8 | |
| β-strand | 277-281 | 5 | 8 |
| β-strand | 289-291 | 3 | 8 |
| α-helix | 294-301 | 8 | |
Chain F: 10 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 30-40 | 11 | |
| α-helix | 46-59 | 14 | |
| α-helix | 65-75 | 11 | |
| β-strand | 104-108 | 5 | 9 |
| α-helix | 115-127 | 13 | |
| β-strand | 133-136 | 4 | 9 |
| α-helix | 145-156 | 12 | |
| β-strand | 160-161 | 2 | 9 |
| α-helix | 169-182 | 14 | |
| β-strand | 187-190 | 4 | 9 |
| α-helix | 200-216 | 17 | |
| β-strand | 223-229 | 7 | 9 |
| β-strand | 232 | 1 | 6 |
| α-helix | 235-247 | 13 | |
| β-strand | 251-255 | 5 | 9 |
| α-helix | 266-273 | 8 | |
| β-strand | 277-281 | 5 | 9 |
| β-strand | 289-291 | 3 | 9 |
| α-helix | 294-301 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Signal recognition particle protein | A, B, C | protein | 294 | THERMUS AQUATICUS | O07347 (AlphaFold model) |
| Cell division protein ftsy | D, E, F | protein | 284 | THERMUS AQUATICUS | P83749 (AlphaFold model) |
Sequence of entity 1 (A, B, C), FASTA
>2CNW_1 SIGNAL RECOGNITION PARTICLE PROTEIN (chains A, B, C)
MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEAL
GKQVLESLTPAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLAL
YYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEA
RDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVT
GLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGM
Sequence of entity 2 (D, E, F), FASTA
>2CNW_2 CELL DIVISION PROTEIN FTSY (chains D, E, F)
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPDE
RRATLRKLGFNPQKPKPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDT
FRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKH
NLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGT
AKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLED
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 6 |
| MG | Magnesium ion | Mg | 6 |
| ALF | Tetrafluoroaluminate ion | Al F4 | 6 |
| 5GP | Guanosine-5'-monophosphate | C10 H14 N5 O8 P | 3 |
Primary citation
Structure of a Gdp:Alf(4) Complex of the Srp Gtpases Ffh and Ftsy, and Identification of a Peripheral Nucleotide Interaction Site. Focia, P.J., Gawronski-Salerno, J., Coon V, J.S. et al. J Mol Biol (2006) 360:631. DOI 10.1016/J.JMB.2006.05.031 · PubMed
Other PDB entries of the same protein (UniProt O07347 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1LS1 1.1 Å, T. aquaticus Ffh NG Domain at 1.1A Resolution
- 2J45 1.14 Å, Water structure of T. Aquaticus Ffh NG Domain At 1.1A Resolution
- 2J46 1.14 Å, Water structure of T. Aquaticus Ffh NG Domain At 1.1A Resolution
- 2C04 1.15 Å, GMPPCP complex of SRP GTPase Ffh NG Domain at ultra-high resolution
- 2C03 1.24 Å, GDP complex of srp gtpase ffh ng domain
- 1JPN 1.9 Å, GMPPNP Complex of SRP GTPase NG Domain
- 1RJ9 1.9 Å, Structure of the heterodimer of the conserved GTPase domains of the Signal Recognition…
- 2J7P 1.97 Å, GMPPNP-stabilized NG domain complex of the SRP GTPases Ffh and FtsY
- 2NG1 2.02 Å, N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
- 1NG1 2.03 Å, N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
- 1FFH 2.05 Å, N and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
- 1OKK 2.05 Å, Homo-heterodimeric complex of the srp gtpases
Browse structure collections
About this viewer
MolViewer shows 2CNW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.