2CP6: 2nd CAP-Gly domain in human CLIP-170/restin

Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin. Determined by solution NMR. Released 19 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,233
Mol. weight: 17.61 kDa
Released: 19 Nov 2005

Explore 2CP6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CP6 contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	44-47	4	1
β-strand	51-60	10	1
β-strand	67-73	7	1
β-strand	80	1	1
β-strand	83-84	2	2
β-strand	87-88	2	2
β-strand	97-101	5	1
α-helix	102-104	3
β-strand	106-107	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Restin	A	protein	172	Homo sapiens	P30622 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CP6_1 Restin (chains A)
GSSGSSGATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGE
TDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKA
NAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSGPSSG

Primary citation

Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin. Saito, K., Koshiba, S., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt P30622 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2E3H 1.45 Å, Crystal structure of the CLIP-170 CAP-Gly domain 2
3RDV 1.75 Å, Structure of the SLAIN2c-CLIPCG1 complex
2HQH 1.8 Å, Crystal structure of p150Glued and CLIP-170
8WHI 1.85 Å, Crystal structure of native CLASP2 in complex with CLIP170
2E3I 2.0 Å, Crystal structure of the CLIP-170 CAP-Gly domain 1
2QK0 2.0 Å, Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
3E2U 2.6 Å, Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly…
8WHH 3.8 Å, Crystal structure of Se-Met derivative CLASP2 in complex with CLIP170
2CP5 Solution structure of the 1st CAP-Gly domain in human CLIP-170/restin
2E4H Solution structure of cytoskeletal protein in complex with tubulin tail

Browse structure collections

About this viewer

MolViewer shows 2CP6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.