2E4H: Cytoskeletal protein

Solution structure of cytoskeletal protein in complex with tubulin tail. Determined by solution NMR. Released 28 Aug 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 633
Mol. weight: 14.56 kDa
Released: 28 Aug 2007

Explore 2E4H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2E4H contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	217-220	4	1
β-strand	224-232	9	1
β-strand	241-246	6	1
β-strand	253	1	1
β-strand	256-257	2	2
β-strand	260-261	2	2
β-strand	270-273	4	1
β-strand	279-280	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Restin	A	protein	98	Homo sapiens	P30622 (AlphaFold model)
Tubulin alpha-ubiquitous chain	B	protein	36	Homo sapiens	P68363 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2E4H_1 Restin (chains A)
GSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRY
FQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVM

Sequence of entity 2 (B), FASTA

>2E4H_2 Tubulin alpha-ubiquitous chain (chains B)
GEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Primary citation

Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. Mishima, M., Maesaki, R., Kasa, M. et al. Proc Natl Acad Sci U S A (2007) 104:10346-10351. DOI 10.1073/pnas.0703876104 · PubMed

Other PDB entries of the same protein (UniProt P30622 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2E3H 1.45 Å, Crystal structure of the CLIP-170 CAP-Gly domain 2
3RDV 1.75 Å, Structure of the SLAIN2c-CLIPCG1 complex
2HQH 1.8 Å, Crystal structure of p150Glued and CLIP-170
8WHI 1.85 Å, Crystal structure of native CLASP2 in complex with CLIP170
2E3I 2.0 Å, Crystal structure of the CLIP-170 CAP-Gly domain 1
2QK0 2.0 Å, Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
3E2U 2.6 Å, Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly…
8WHH 3.8 Å, Crystal structure of Se-Met derivative CLASP2 in complex with CLIP170
2CP5 Solution structure of the 1st CAP-Gly domain in human CLIP-170/restin
2CP6 Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin

Browse structure collections

About this viewer

MolViewer shows 2E4H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.