2CQ0: PDB entry 2CQ0

solution structure of RNA binding domain in eukaryotic translation initiation factor 3 subunit 4. Determined by solution NMR. Released 19 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 785
Mol. weight: 11.14 kDa
Released: 19 Nov 2005

Explore 2CQ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CQ0 contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	239-244	6	1
α-helix	252-256	5
β-strand	265-272	8	1
β-strand	279-287	9	1
α-helix	290-299	10
β-strand	304-305	2	2
β-strand	308-309	2	2
β-strand	311-314	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit 4	A	protein	103	Homo sapiens	O75821 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CQ0_1 Eukaryotic translation initiation factor 3 subunit 4 (chains A)
GSSGSSGPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFA
FISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTNSGPSSG

Primary citation

solution structure of RNA binding domain in eukaryotic translation initiation factor 3 subunit 4. Tsuda, K., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt O75821 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PPL 2.65 Å, MERS-CoV Nsp1 bound to the human 43S pre-initiation complex
8PJ5 2.9 Å, Structure of human 48S translation initiation complex after eIF2 release prior 60S…
8PJ6 2.9 Å, Structure of human 48S translation initiation complex with initiator tRNA, eIF1A and…
6YBS 3.1 Å, Structure of a human 48S translational initiation complex - head
8PJ4 3.2 Å, Structure of human 48S translation initiation complex after eIF5 release (48S-4)
8XXM 3.2 Å, Cryo-EM structure of the human 40S ribosome with PDCD4 and eIF3G
8PJ1 3.4 Å, Structure of human 48S translation initiation complex in open codon scanning state (48S-1)
8PJ2 3.4 Å, Structure of human 48S translation initiation complex in AUG recognition state after…
8OZ0 3.5 Å, Structure of a human 48S translation initiation complex with eIF4F and eIF4A
8XXN 3.6 Å, Cryo-EM structure of the human 43S ribosome with PDCD4
6ZMW 3.7 Å, Structure of a human 48S translational initiation complex
7QP7 3.7 Å, Structure of the human 48S initiation complex in closed state (h48S AUG closed)

Browse structure collections

About this viewer

MolViewer shows 2CQ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.